DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14826 and CG33342

Sequence 1:NP_001097528.2 Gene:CG14826 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097904.1 Gene:CG33342 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster

Alignment Length:202 Identity:63/203 (31%)
Similarity:96/203 (47%) Gaps:15/203 (7%)


  Fly     8 LLAVAMLSLPSRGD-SSRNLTEFMG-HRQKRWLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCVLS 70
            :|.:.:|:..:.|| :.||.:..:. .|.||..|:...|:.|...|.:.||...|.|......::
  Fly    15 VLLLFVLAASAAGDGNDRNASPGLSLSRTKRLAIFNGQGTNKIVAGLAFPIKQADTVQSVWGFVN 79

  Fly    71 YTLQGGSYSLPTSPIWPWDKWE-GTFARSLMQMRRNIERHVANGGVRYADDARLLVYTALEEYMG 134
            |..|   |.....||:.|..|. .||..:..:.|:.|...|      :.|:.|:.:|..:|..: 
  Fly    80 YQAQ---YVPSPVPIYWWSFWNTSTFLSTAREWRKGIRSRV------FQDETRVWLYDVVETGL- 134

  Fly   135 RRNNDRSMGRQCLLRSICENAQ-IHHHIGVFSEIMDIVLSPGKADLDNDYHDAYAAGRAGANCLG 198
            .|..||:.| .|||:.|||.:| ...|..:|.||::.||.|...::...|..|..||:|||||..
  Fly   135 ERLGDRNAG-ACLLKCICEISQRPFMHNSIFGEILNAVLVPSLDNVPEKYLHARNAGKAGANCRK 198

  Fly   199 LYSACPR 205
            .||.|.:
  Fly   199 TYSDCSK 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 34/91 (37%)
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 32/82 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130746538
eggNOG 1 0.900 E1_2E2BX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.