DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dscam2 and PAPLN

Sequence 1:NP_001261500.1 Gene:Dscam2 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN HGNCID:19262 Length:1278 Species:Homo sapiens

Alignment Length:1041 Identity:222/1042 (21%)
Similarity:327/1042 (31%) Gaps:368/1042 (35%)


  Fly    47 SGGWLDCSAS---GSPQPTVDWVHADGSAVTEI-------------------------------- 76
            :|.|..||||   ||...:|..:.:||:.:.|.                                
Human   368 AGPWAPCSASCGGGSQSRSVYCISSDGAGIQEAVEEAECAGLPGKPPAIQACNLQRCAAWSPEPW 432

  Fly    77 --------HGVRR-----------VLRNGTLVL---MPFAAAAYHQDV--------H-NTIYRCI 110
                    .|||:           :|......|   .|......|:|.        | .|...|.
Human   433 GECSVSCGVGVRKRSVTCRGERGSLLHTAACSLEDRPPLTEPCVHEDCPLLSDQAWHVGTWGLCS 497

  Fly   111 ASNSVGRIVSRDVQVRAVVA---------QAYKVDVEVLSAARGCTAILRCVVPTFVKELVRVVS 166
            .|.|.|   :|..||...:.         .:..||||..:..           |..:.:.|..:.
Human   498 KSCSSG---TRRRQVICAIGPPSHCGSLQHSKPVDVEPCNTQ-----------PCHLPQEVPSMQ 548

  Fly   167 WVHEP-----------------------AIYIYPSLQGD-----GKFHLLPTGELLIH------- 196
            .||.|                       |...:||.:||     |.    |.|:...|       
Human   549 DVHTPASNPWMPLGPQESPASDSRGQWWAAQEHPSARGDHRGERGD----PRGDQGTHLSALGPA 609

  Fly   197 -NLQESDESQSFRCRSMHRLTRQVVVSSPTRLRINSHRGIISPSVVEHTAHVQVSQDEGAVLLCV 260
             :||:....|..|..|                         .|....|:.|........|.|...
Human   610 PSLQQPPYQQPLRSGS-------------------------GPHDCRHSPHGCCPDGHTASLGPQ 649

  Fly   261 AQGCPSPEYSWFTHNGAGP--LPVLSGPRVRLLGPILAIEAVTGEDSGVYKCTAG-NVGG-EASA 321
            .||||...... :..|..|  :.|..||                ..:|..|...| :.|| ..|.
Human   650 WQGCPGAPCQQ-SRYGCCPDRVSVAEGP----------------HHAGCTKSYGGDSTGGMPRSR 697

  Fly   322 ELRLTVATPIQVEISPNVLSVHMGGTAEFRCL---VTSNGSPVGM----QNILWYKDGRQLPSS- 378
            .:..||....|.:...|..|...|  ::|.|.   |.:...|:|.    |....|.....|||: 
Human   698 AVASTVHNTHQPQAQQNEPSECRG--SQFGCCYDNVATAAGPLGEGCVGQPSHAYPVRCLLPSAH 760

  Fly   379 GRVEDTLV----VPRVSRENRGMY--------------QCV---------VRRPEGDTFQATAEL 416
            |...|...    |..|.:.||..|              :|:         .|||:......:...
Human   761 GSCADWAARWYFVASVGQCNRFWYGGCHGNANNFASEQECMSSCQGSLHGPRRPQPGASGRSTHT 825

  Fly   417 QLGDAPPVLLYSFIEQTLQP-----GPAVSLKCSAAGNPTPQISWTLDGFPLPSN-------GRF 469
            ..|.:.|.     .||  :|     |.||..|...:|.     .|..|..|.|..       |.:
Human   826 DGGGSSPA-----GEQ--EPSQHRTGAAVQRKPWPSGG-----LWRQDQQPGPGEAPHTQAFGEW 878

  Fly   470 MIGQYI-----TVHGDVISHVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGL-PYIRLIPK 528
            ..||.:     .:.||..|.....|                    ..:.|:::.|: |.:     
Human   879 PWGQELGSRAPGLGGDAGSPAPPFH--------------------SSSYRISLAGVEPSL----- 918

  Fly   529 VTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWAR 593
            |.|..|:.:.|.|.....|..:..|::.|:.:..| |.|:|.||||.|.|:|. .|:|.|:| ..
Human   919 VQAALGQLVRLSCSDDTAPESQAAWQKDGQPISSD-RHRLQFDGSLIIHPLQA-EDAGTYSC-GS 980

  Fly   594 NKQGHSARR------SGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGR 652
            .:.|..:::      .|::.|:...:||.|.                                 :
Human   981 TRPGRDSQKIQLRIIGGDMAVLSEAELSRFP---------------------------------Q 1012

  Fly   653 PIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDA 717
            |.||.|                 :.|..........:.:|..:..|...|..|.|     ..|||
Human  1013 PRDPAQ-----------------DFGQAGAAGPLGAIPSSHPQPANRLRLDQNQP-----RVVDA 1055

  Fly   718 NVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFY 782
            :  ..:.|.:.|:|:|.|.|:|.|::.....|.        |..:|..:|||::..|..:..|||
Human  1056 S--PGQRIRMTCRAEGFPPPAIEWQRDGQPVSS--------PRHQLQPDGSLVISRVAVEDGGFY 1110

  Fly   783 LCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNTL 847
            .|.|.||.... .:.:||:|......|....:|.|.:||||.|.|.|:|:. :||.|.|:|    
Human  1111 TCVAFNGQDRD-QRWVQLRVLGELTISGLPPTVTVPEGDTARLLCVVAGES-VNIRWSRNG---- 1169

  Fly   848 NPSTNYKISVKQEA-----TPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQL---VQLQVQE 904
                   :.|:.:.     :|||.   |.|..:.|.|.|.|.|.|   |...|.:   .:::|..
Human  1170 -------LPVQADGHRVHQSPDGT---LLIYNLRARDEGSYTCSA---YQGSQAVSRSTEVKVVS 1221

  Fly   905 P 905
            |
Human  1222 P 1222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845 27/142 (19%)
Ig 138..>203 CDD:299845 17/101 (17%)
I-set 238..327 CDD:254352 21/93 (23%)
Ig 247..327 CDD:299845 18/84 (21%)
I-set 332..418 CDD:254352 25/121 (21%)
IGc2 344..407 CDD:197706 22/98 (22%)
IG_like 432..517 CDD:214653 19/102 (19%)
IGc2 436..507 CDD:197706 17/88 (19%)
I-set 521..610 CDD:254352 27/95 (28%)
IGc2 533..597 CDD:197706 21/64 (33%)
Ig 630..699 CDD:143165 7/69 (10%)
IG_like 714..802 CDD:214653 27/88 (31%)
Ig 725..802 CDD:299845 24/77 (31%)
Ig 823..894 CDD:143165 23/76 (30%)
FN3 906..1006 CDD:238020 222/1042 (21%)
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559 12/55 (22%)
TSP1 424..481 CDD:214559 8/57 (14%)
TSP1 488..539 CDD:214559 14/65 (22%)
Kunitz_BPTI 753..805 CDD:278443 11/52 (21%)
Papilin_u7 814..905 CDD:318767 22/123 (18%)
Ig 914..>978 CDD:325142 23/71 (32%)
I-set 1049..1119 CDD:254352 26/85 (31%)
IG 1139..1219 CDD:214652 29/98 (30%)
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.