DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dscam2 and dscama

Sequence 1:NP_001261500.1 Gene:Dscam2 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:XP_021334866.1 Gene:dscama ZFINID:ZDB-GENE-050310-7 Length:2025 Species:Danio rerio

Alignment Length:2090 Identity:626/2091 (30%)
Similarity:1003/2091 (48%) Gaps:203/2091 (10%)


  Fly     1 MWISSRFFVILLLLNLDNTCSEPFEAHLRGPGFVMEPPGRVEFSNSSGGWLDCSASGSPQPTVDW 65
            |||.:..|...:|    |..||...:.|.   ||......|.|::::|..:.|.|:..|..|:.|
Zfish     1 MWILAIIFFQCIL----NVLSEDLHSSLY---FVNASLQEVVFASTTGTLVPCPAAAVPPATLRW 58

  Fly    66 VHADGSAVTEIHGVRRVLRNGTLVLMPFAAAAYHQDVHNTIYRCIASNSVGRIVSRDVQVRAVVA 130
            ..|.|.....:.|:|.|..||||.:..|..:::.:.:|:..|.|.|.|..|:|.|:||.::||:.
Zfish    59 YLATGEESYNVPGIRHVHPNGTLQIFHFPPSSFSKVIHDNTYYCTAENPSGKIRSQDVHIKAVLR 123

  Fly   131 QAYKVDVEVLSAARGCTAILRCVVPTFVKELVRVVSWVHEPAIYIYPSLQGDGKFHLLPTGELLI 195
            :.|.|.|...:|.||..|:.:|::|:.|:..:.||||..:..    |.:.| .:|.:..||.|.|
Zfish   124 EPYTVRVADQTAMRGSVAVFKCIIPSSVENYITVVSWERDTV----PLVSG-ARFLITSTGALYI 183

  Fly   196 HNLQESDESQSFRCRSMHRLTRQVVVSSPTRLRINSHRGIISPSVVEHTAHVQVSQDEGAVLLCV 260
            .::|:.||..::||.:.||.|.:...|:..||.:.:.....:|::::.....:|.......|.|.
Zfish   184 LDVQKEDELFNYRCMTRHRYTSETRQSNSARLFVPADPSNSAPAILDGFEKREVMASHRVELPCK 248

  Fly   261 AQGCPSPEYSWFTHNGAGPLPVLSGPRVRLLGPILAIEAVTGEDSGVYKCTAGNVGGEASAELRL 325
            |.|.|:|:|.|..:|    .|:.|..|.|.....|.||.....|:|.|.|...|..|.|....||
Zfish   249 ASGHPAPKYRWLKNN----RPLESDSRFRQSVTGLLIERAQPSDTGSYVCEVWNSYGNAEVIGRL 309

  Fly   326 TVATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILWYKDGRQLPSSGRV------EDT 384
            ||..|::..:||..:...:|......|.||.:..    ..:.||::|.::.:...:      ::.
Zfish   310 TVKEPLKAVVSPRKVKGSVGSQVSLSCSVTGSDE----FELSWYRNGDKINTGANIRMNGINKEN 370

  Fly   385 LVVPRVSRENRGMYQCVVRRPEGDTFQATAELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGN 449
            ||:..:::.:.|:|||..|:.:... |...::.|.|..|.:|.:|.|:.:.|...|||.|...|.
Zfish   371 LVMDGMAKSDGGVYQCFSRKAKMSA-QDFVQVILEDGTPKILSAFSEKVVGPNDFVSLTCHVKGT 434

  Fly   450 PTPQISWTLDGFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAENRAGRVQHAAR 514
            |.|.|:||||...:..:.|..|...||..|:|:|::||||:.|.|.|.|.|...|.||.|.:.||
Zfish   435 PQPAITWTLDDEVVAKDSRHRIVHSITAEGNVVSYLNISHIQVRDSGVYRCTCNNSAGTVSYQAR 499

  Fly   515 LNIYGLPYIRLIPKVTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDIRQRV-QPDGSLTISP 578
            :|:.|...||.:..:||::|..:.:.|.|.|||...|.|.:....||.:.|||. :.:|:|.:..
Zfish   500 INVRGSADIRPMKNLTAIAGWDMYIHCHVIGYPYYSIKWFKNSNLLPFNDRQRAFENNGTLKLLN 564

  Fly   579 VQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPL 643
            |||..|.|.|:|..:.:......:|..|||.|||.:.||:  ..:.::|.|..:.|.|..||||:
Zfish   565 VQKELDEGEYSCHVQVQPQLFKNQSVHVTVKVPPFIQPFE--FPRYSIGHRVFVPCVVRSGDLPI 627

  Fly   644 TINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPP 708
            :|.|.|||:.|:.:..:::..:| :.|.|.|.||...|.|.|:|:.:|.||.|:....|:|.|||
Zfish   628 SITWEKDGKSINASLGVTIDNID-FTSSLRISNLQRVHNGTYTCIAQNDAAVVKYQSQLIVRVPP 691

  Fly   709 RWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVR-ERPF-TKLLGNGSLLL 771
            |:.|:|.|.:....:.::|:|.|.|.|.|:|.||.:.|:...:::.:. ...| .:||||||||:
Zfish   692 RFKVQPQDQDGIYGKSVILNCSADGEPRPTIEWKYSKGAGVPQFQPIALNSGFRVQLLGNGSLLI 756

  Fly   772 QHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPIN 836
            :||.|:..|:|||:.:|.:|..:.|.:.|.|......:|...:.:..||:...:.|...|:|||.
Zfish   757 KHVLEEDAGYYLCKVSNDVGADVSKSMYLNVKIPAMITSYPNNSLATKGEKIEMSCKAHGEKPIM 821

  Fly   837 IVWMR-----SGKNTLNPST-NYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQ 895
            :.|.:     ...:.:||.. .:.::||.  ..|.|.:.|||......|||.:.|.|.|.||.|:
Zfish   822 VRWEKEVEKEKQSHMINPDMWRHTVTVKN--VGDEVVSTLQIYPTMREDSGFFSCHAINSYGEDR 884

  Fly   896 QLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPALFVDQWQ 960
            .::||.|||||.||.| |...:..|::.::|.....|...:|.|.:|.:..         .:.|:
Zfish   885 GILQLTVQEPPEPPKV-EIREVKERTIALRWTMGFDGNSLITGYDIECKNK---------TETWE 939

  Fly   961 QI-EVKD-PPHFN-AMIENLKPATRYAFRVIAEGSAGRSAPSQELIVRTEPQRPAGPPLSLSARP 1022
            :. ..:| .|..| |.|..|.|::.|..|:.|:...|.|.||.||.|.|:...|.|||..::...
Zfish   940 RARRTRDVSPTLNQATIIELHPSSTYNIRMFAKNHIGDSEPSNELTVTTDEADPEGPPQDVTLEA 1004

  Fly  1023 LSSTELLISWVAPLPELRHGDIQGYNVGYKLSSSGNTAYNFTSVSGDGDGGNGELLLSGLAKFAR 1087
            ::|..:.::|.|||..|::|.|:||.|.:: ..|.|.::.|..:|.:..|....|.|:.|.|||.
Zfish  1005 ITSQSIKVTWKAPLKHLQNGVIRGYQVCHR-EHSTNGSHQFVCISVEATGETESLSLNNLKKFAE 1068

  Fly  1088 YTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRPPEDVRCAALSSQSLQVSWQPPPIYHTNGLLQGY 1152
            |.|||||.|..||||.|....|.||||||||.||.|...|.|.:|:.:|||.|.....||:|||:
Zfish  1069 YEVVVQASNSAGPGPASSEVRATTMEDVPSRAPEKVVATAASPESISLSWQTPAREALNGVLQGF 1133

  Fly  1153 KLIFEPIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQVLAHTRMGDGVVSKPLFCHSEED 1217
            ::|:...:.|  ....|:.:..|....:.|.||.|||||||||||.||.||||.|..::..::||
Zfish  1134 RIIYWANLPD--GELGEIRNVTTHKAPLELEGLEKYTNYSIQVLAFTRAGDGVRSDQIYIRTKED 1196

  Fly  1218 VPEAPADIKVVSSSSQSLYISWLPPNEPNGVITKYSLY-----TRVVNGREELNNEKRSLPSQQA 1277
            ||..|..:|..::||..:|:|||||.:.||||.||:::     ..||:..|        :...:.
Zfish  1197 VPGPPGGVKAAAASSSVVYVSWLPPLKLNGVIRKYTVFCSSTSPTVVSEFE--------VAPDEF 1253

  Fly  1278 YYEAKGLHPHMEYQFWVTASTRVGEGKSSRVSSQITTNRIPARIISFGGPVVRPWRSTVTLPCTA 1342
            .:....|..:.:|..||.|.|..|.|.||.|.:.....:.||:|::|.|.|..||...|.|||.|
Zfish  1254 LHRVHNLSRNRKYNIWVMAVTAAGRGNSSDVITVEPLAKAPAKILTFSGTVTTPWMRDVVLPCRA 1318

  Fly  1343 VGKPKR--EWFKSDVALRQGGLHNSQLLD-------SGDLIISSLQLADGGNYSCQVDNGIGTDR 1398
            ||.|..  :|      |::.|.....::|       :|..||.:::..|.|.|:|...|..|||.
Zfish  1319 VGDPPPAIKW------LKESGSPAPAVIDGRRSIHGNGSFIIKTVKAEDSGYYTCVASNNYGTDE 1377

  Fly  1399 LTHTLIVQVPPTAPVLYVTSATSSSILMHWKCGFTGNAPITGYTLFYRRANGNT-DEMQLSRHAS 1462
            :...|.|||||..|.|.||..|::||.:.|..|..|.:.|.||.|.|...|... ..:.:|....
Zfish  1378 IILNLQVQVPPDQPRLTVTKTTTTSITVTWTPGDNGGSSIRGYILQYSEDNSEKWGSISISPSER 1442

  Fly  1463 SHELKGLMCGSTYQIHLSAQNKVGTSPTSTILHVRTQGQSPGHPASTALLAP-NSTSLLVRLHSW 1526
            |:.|:.|.||:.|:..|:|||.||....|.|:..:|.|:.|.......|... |.||:.:.|..|
Zfish  1443 SYRLENLNCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQFSKEQELFTSINGTSVKLNLIGW 1507

  Fly  1527 PDNGCPLLYFVLQYRAVTDDPDAEWVLVSNALKPQRRIV-----INNLQPSTLYQLRMEAHNVAG 1586
            .|.|||:..|.|:||.: :.|  .|.      |.:|..:     :.:||.:|.|:|:|:.:|.||
Zfish  1508 NDGGCPITSFTLEYRPL-ESP--VWT------KAKRTSLSKSYNLLDLQEATWYELQMKVYNSAG 1563

  Fly  1587 ISQAEFNFVTLTKDGDPPPPEIMHRGRSGQTTVIFANINLLIPTIAAVSGMFCTIIMIIVCYRH- 1650
            :::....|.||:.||...||.:....:..........:.:::.....:.||....::::|..|. 
Zfish  1564 LAEKRVKFATLSYDGSTIPPLVKTLVKDPVKKTSNEGMKMMVTISCILVGMVLLFVLLMVLRRRR 1628

  Fly  1651 ------MLKNAPPLAEQSQIQKESLENRANSEAAQRERYYATIHKVSMQNNDKIPETSEDISPYA 1709
                  .|::|..|||. .:.|.:..:...::..|..|.:..|.:..:...::  :|.|.:...:
Zfish  1629 REQRLKRLRDAKSLAEM-LMSKNTRPSDTMNKQQQTLRMHIDIPRAQLLIEER--DTMETVDDRS 1690

  Fly  1710 TFQL--SEAGGNMSQPHHGGPANTLLHSFMYHERALAEG----CSSPPPAASKN-----RRRHSR 1763
            |..|  ::.|....|     .:.|:.||..|...:.|.|    .|...|..||:     ..|.:.
Zfish  1691 TVLLTDNDFGETAKQ-----KSATVTHSVHYQSLSQATGPLVDVSDVRPGTSKSSLSNPTSRRTA 1750

  Fly  1764 KTEPESEESESDQ------------------------------DQLTSSRTESSNQHEGKIKHSI 1798
            |..|.:....:.|                              |:.:.|.:.|.:|...:.:.|:
Zfish  1751 KAGPAARNRYASQWTLNRPHPPVSVHTLSTDWRLGTPRVAGSVDKESDSYSVSPSQDTDRARSSM 1815

  Fly  1799 IYHGAQSSTSSDLSPMSEQKSLPRRGRSRYHHQQYQ----FSTNTTPRHHNSNKMNNNTTSNTNT 1859
            :...:.|||..:|:...|...:..:.|    |.::.    |.::|:.....:. .|:.|.|.|::
Zfish  1816 VSTESASSTYEELARAYEHAKMEEQLR----HAKFTITECFISDTSSEQMTAG-TNDYTDSLTSS 1875

  Fly  1860 TATNT-----TATPSTSSNSNKILS---PR----GGNL--------------KSISST------- 1891
            |.:.:     ||:|....:..::::   |:    ||.|              :.:|.|       
Zfish  1876 TPSESGICRFTASPPKPQDVCRVINMAVPKAHRPGGELVHLPPYLRMDFLLNRGVSGTSREAAMG 1940

  Fly  1892 ---FKSQDSIQCHIPTLVKSPSISTQQQKQFHKQQLQNSSTNNSQHSSSN-PNSSSLKQQQPLLI 1952
               .:.|.:.....|.|::...:.....:...:.|...:||...:.:.:: ..::.:...|..|:
Zfish  1941 QACLEPQKTRSLKRPALLEPTPMEVPTSRDVQQWQSGTASTLPQREAGTDLAQAAKISTSQESLL 2005

  Fly  1953 TPKLHQLEAN 1962
            ..:.|..:.|
Zfish  2006 DSRGHLKQTN 2015

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845 25/76 (33%)
Ig 138..>203 CDD:299845 20/65 (31%)
I-set 238..327 CDD:254352 28/89 (31%)
Ig 247..327 CDD:299845 27/80 (34%)
I-set 332..418 CDD:254352 17/92 (18%)
IGc2 344..407 CDD:197706 14/69 (20%)
IG_like 432..517 CDD:214653 36/85 (42%)
IGc2 436..507 CDD:197706 31/71 (44%)
I-set 521..610 CDD:254352 30/90 (33%)
IGc2 533..597 CDD:197706 22/65 (34%)
Ig 630..699 CDD:143165 26/69 (38%)
IG_like 714..802 CDD:214653 32/90 (36%)
Ig 725..802 CDD:299845 30/79 (38%)
Ig 823..894 CDD:143165 23/77 (30%)
FN3 906..1006 CDD:238020 29/103 (28%)
FN3 1013..1111 CDD:238020 38/98 (39%)
FN3 1119..1209 CDD:238020 40/90 (44%)
FN3 1219..1313 CDD:238020 31/99 (31%)
Ig 1336..1402 CDD:143165 23/75 (31%)
FN3 1409..1498 CDD:238020 32/90 (36%)
FN3 1515..1588 CDD:238020 26/78 (33%)
dscamaXP_021334866.1 Ig 124..217 CDD:325142 32/98 (33%)
I-set 236..311 CDD:254352 27/79 (34%)
IG_like 321..402 CDD:214653 16/86 (19%)
I-set 408..502 CDD:333254 40/94 (43%)
IGc2 524..579 CDD:197706 21/55 (38%)
Ig 614..679 CDD:319273 25/66 (38%)
Ig_DSCAM 708..787 CDD:143211 30/79 (38%)
Ig 805..898 CDD:325142 33/95 (35%)
FN3 894..988 CDD:238020 30/104 (29%)
FN3 995..1092 CDD:238020 38/98 (39%)
fn3 1100..1186 CDD:306538 39/88 (44%)
fn3 1199..1282 CDD:306538 28/91 (31%)
Ig 1312..1377 CDD:319273 23/71 (32%)
fn3 1405..1471 CDD:306538 22/66 (33%)
FN3 1492..1563 CDD:238020 25/80 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 938 1.000 Inparanoid score I325
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001376
OrthoInspector 1 1.000 T128553
orthoMCL 1 0.900 OOG5_128592
Panther 1 1.100 O PTHR10075
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.