DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dscam2 and PTPRQ

Sequence 1:NP_001261500.1 Gene:Dscam2 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:XP_016874762.1 Gene:PTPRQ HGNCID:9679 Length:2536 Species:Homo sapiens

Alignment Length:1699 Identity:351/1700 (21%)
Similarity:577/1700 (34%) Gaps:539/1700 (32%)


  Fly   435 QPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYI-----------TVHGDVISHVNIS 488
            :|||.|.|.....|:....:||..   |...|||.:  .||           ||:..|.|..:..
Human   277 KPGPPVFLAGERVGSAGILLSWNT---PPNPNGRII--SYIVKYKEVCPWMQTVYTQVRSKPDSL 336

  Fly   489 HVMVED---GGEY--ACIAENRAGRVQHAARLNIYGLPYIRLIPKVTAVSGETLNLKCPVAGYPI 548
            .|::.:   |..|  ...|||.||       :.::..|:  |.....:..|:.:||.........
Human   337 EVLLTNLNPGTTYEIKVAAENSAG-------IGVFSDPF--LFQTAESAPGKVVNLTVEAYNASA 392

  Fly   549 EEIHWERGGRELPDDIRQRVQPDGSLT-----------------------------ISPVQKNSD 584
            .::.|     .||.      ||:|.:|                             :....:||:
Human   393 VKLIW-----YLPR------QPNGKITSFKISVKHARSGIVVKDVSIRVEDILTGKLPECNENSE 446

  Fly   585 S------------GVYTCWARNKQGHSARRSGEVTVI-------VPPKLSPFQTNILQLNMGDRA 630
            |            |..|..:|.....|.....|::.:       |...|.|:.|.:.:::     
Human   447 SFLWSTASPSPTLGRVTPPSRTTHSSSTLTQNEISSVWKEPISFVVTHLRPYTTYLFEVS----- 506

  Fly   631 SLTCSVVKGDLPLTINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVVR---NS 692
              ..:...|.:..||....:..|..|.|:.....:.. .|..::.:..:..||.:|..|.   .|
Human   507 --AATTEAGYIDSTIVRTPESVPEGPPQNCVTGNITG-KSFSILWDPPTIVTGKFSYRVELYGPS 568

  Fly   693 AAEVENS----QALLVNVPP-----RWIVEPVDANVERNRHIMLHCQAQGVPTP----------- 737
            ...::||    :....|:.|     .:|.....|......:|       .|.||           
Human   569 GRILDNSTKDLKFAFTNLTPFTMYDVYIAAETSAGTGPKSNI-------SVFTPPDVPGAVFDLQ 626

  Fly   738 ---------SIVWKKATGSKSGEYEEVRERPF----------TKLLGNGSLL-------LQHVKE 776
                     .|.|||.. ..:|...:.|.:..          |.|.||...:       :.::.|
Human   627 LAEVESTQVRITWKKPR-QPNGIINQYRVKVLVPETGIILENTLLTGNNEYINDPMAPEIVNIVE 690

  Fly   777 DREGFYLCQANNGIGTGIGKVIQLKVNSSP--YFSSTSR-----SVMVKKGDTALLQCAVSGDKP 834
            ...|.|  :.:..:.:.:..:.....||.|  .|.:.:|     |.:|...:..:...|.   :.
Human   691 PMVGLY--EGSAEMSSDLHSLATFIYNSHPDKNFPARNRAEDQTSPVVTTRNQYITDIAA---EQ 750

  Fly   835 INIVWMRSGKNTLNPSTNYKISVKQ-EATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLV 898
            ::.|..|     |.|.|.:.|||.. ....:|....|.:||                        
Human   751 LSYVIRR-----LVPFTEHMISVSAFTIMGEGPPTVLSVRT------------------------ 786

  Fly   899 QLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPALFVDQWQQIE 963
               .|:.|....::....|||.|:.:.|.|.....|.:|.|.:...|.|        .::..||.
Human   787 ---RQQVPSSIKIINYKNISSSSILLYWDPPEYPNGKITHYTIYAMELD--------TNRAFQIT 840

  Fly   964 VKDPPHFNAMIENLKPATRYAFRVIAEGSAGRSAPSQE--LIVRTEPQRPAGPPLSLSARPLSST 1026
            ..|.   :.:|..||..|:|..||.|....|.|:.|:|  :.|||....|...|..:....:::.
Human   841 TIDN---SFLITGLKKYTKYKMRVAASTHVGESSLSEENDIFVRTSEDEPESSPQDVEVIDVTAD 902

  Fly  1027 ELLISWVAPLPELRHGDIQGYNVGYKLSSSGNTAYNFTSVSGDGDGGNGELLLSGLAKFARYTVV 1091
            |:.:.| :| ||..:|.|..|.|.||   :.:|.|...:.:.|       ::|..|.....|.:.
Human   903 EIRLKW-SP-PEKPNGIIIAYEVLYK---NIDTLYMKNTSTTD-------IILRNLRPHTLYNIS 955

  Fly  1092 VQAFNQVGPG-PLSEPTAAQTMEDVPSRPPEDVRCAALSSQSLQVSWQPPPIYHTNGLLQGYKLI 1155
            |:::.:.|.| .:|...:.:|.|.||...||::....:||..:::|:.||.  ..||::|.|.:.
Human   956 VRSYTRFGHGNQVSSLLSVRTSETVPDSAPENITYKNISSGEIELSFLPPS--SPNGIIQKYTIY 1018

  Fly  1156 FEPIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQVLAHTRMGDGVVSKPLFCHSEEDVPE 1220
            .:      :.:.:|..:..||:||..:..|:|||.|.|:|.|.|..|:||.|.|:...:|||.|:
Human  1019 LK------RSNGNEERTINTTSLTQNIKVLKKYTQYIIEVSASTLKGEGVRSAPISILTEEDAPD 1077

  Fly  1221 A-PADIKVVSSSSQSLYISWLPPNEPNGVITKYSLYTRVVNGREELNNEKRSLPSQQAYYEAKGL 1284
            : |.|..|...|..::.:||.||.||||:|..|::|....:..:.:|..:.||       |...|
Human  1078 SPPQDFSVKQLSGVTVKLSWQPPLEPNGIILYYTVYVWNRSSLKTINVTETSL-------ELSDL 1135

  Fly  1285 HPHMEYQFWVTASTRVGEGKSSRVSSQITTNRIPARIISFGGPVVRPWRSTVTLPCTAVGKPKRE 1349
            ..::||..:||||||.|:||:.            :.||||                         
Human  1136 DYNVEYSAYVTASTRFGDGKTR------------SNIISF------------------------- 1163

  Fly  1350 WFKSDVALRQGGLHNSQLLDSGDLIISSLQLADGGNYSCQVDNGIGTDRLTHTLIVQVPPTAPVL 1414
                                                   |...|..:|          ||..  :
Human  1164 ---------------------------------------QTPEGAPSD----------PPKD--V 1177

  Fly  1415 YVTSATSSSILMHWKCGFTGNAPITGYTLFYRRANGNTDEMQLSRHASSHELKGLMCG------- 1472
            |..:.:||||::.|......|..|..|:::||..:| |.....:.|..:::...:...       
Human  1178 YYANLSSSSIILFWTPPSKPNGIIQYYSVYYRNTSG-TFMQNFTLHEVTNDFDNMTVSTIIDKLT 1241

  Fly  1473 --STYQIHLSAQNKVGT-SPTSTILHVRTQGQSP-GHPASTALLAPNSTSLLVRLHSW----PDN 1529
              |.|...|:|...||. :.:|.|:.|.|....| |...:....:.:||::.|   ||    ..|
Human  1242 IFSYYTFWLTASTSVGNGNKSSDIIEVYTDQDIPEGFVGNLTYESISSTAINV---SWVPPAQPN 1303

  Fly  1530 GCPLLY--FVLQYRAVTDDPDAEWVLVSNALKP-----QRRIVINNLQPSTLYQLRMEAHNVAGI 1587
            |....|  .:||.             ....::|     :|.|..:||:..|.|.|::......|.
Human  1304 GLVFYYVSLILQQ-------------TPRHVRPPLVTYERSIYFDNLEKYTDYILKITPSTEKGF 1355

  Fly  1588 SQAEFNFVTLTKDGDPPPPEIMHRGRSGQTTVIFANINLLIPTIAAVSGMFCTIIMIIVCYRHML 1652
            |......:.:..:.|.|           :|:          |.|.....:..|.:        :|
Human  1356 SDTYTAQLYIKTEEDVP-----------ETS----------PIINTFKNLSSTSV--------LL 1391

  Fly  1653 KNAPPLAEQSQIQKESLENRANSEAAQRERYYATIHKVSMQNNDKIPETS------EDISPYATF 1711
            ...||:.....|....|..:..:|      .|:.|             ||      |::||:..:
Human  1392 SWDPPVKPNGAIISYDLTLQGPNE------NYSFI-------------TSDNYIILEELSPFTLY 1437

  Fly  1712 QLSEAGGNMSQPHHG-GPANTLLHSFMYHERA--LAE-------GCS--------SPPPAASKNR 1758
            ....|    ::...| ||::.|   |.|.:.:  ||.       .|:        ||.|......
Human  1438 SFFAA----ARTRKGLGPSSIL---FFYTDESVPLAPPQNLTLINCTSDFVWLKWSPSPLPGGIV 1495

  Fly  1759 RRHSRKTEPESEESESDQDQLTSSRTESSNQHEGKIKHSIIYHGAQSSTSSD-----LSPMSEQK 1818
            :.:|.|.    .|.|:|                      .||:...|...::     |.|:|   
Human  1496 KVYSFKI----HEHETD----------------------TIYYKNISGFKTEAKLVGLEPVS--- 1531

  Fly  1819 SLPRRGRSRYHHQQYQFSTNTTPRHHNSNKMNN-----------NTTSNTNTTATN--------- 1863
                         .|....:...:..|.|:.:|           :...|....||:         
Human  1532 -------------TYSIRVSAFTKVGNGNQFSNVVKFTTQESVPDVVQNMQCMATSWQSVLVKWD 1583

  Fly  1864 ---------TTATPSTSSNSNKILSPRGGN------LKSISSTFKSQ--------DSIQCHIPTL 1905
                     |....:...||.|: ||:...      |.:.|..||.:        |...||:.||
Human  1584 PPKKANGIITQYMVTVERNSTKV-SPQDHMYTFIKLLANTSYVFKVRASTSAGEGDESTCHVSTL 1647

  Fly  1906 VKS-PSIST 1913
            .:: ||:.|
Human  1648 PETVPSVPT 1656

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653 26/98 (27%)
IGc2 436..507 CDD:197706 25/87 (29%)
I-set 521..610 CDD:254352 20/137 (15%)
IGc2 533..597 CDD:197706 16/105 (15%)
Ig 630..699 CDD:143165 13/72 (18%)
IG_like 714..802 CDD:214653 18/125 (14%)
Ig 725..802 CDD:299845 17/114 (15%)
Ig 823..894 CDD:143165 13/72 (18%)
FN3 906..1006 CDD:238020 29/102 (28%)
FN3 1013..1111 CDD:238020 22/99 (22%)
FN3 1119..1209 CDD:238020 29/90 (32%)
FN3 1219..1313 CDD:238020 32/95 (34%)
Ig 1336..1402 CDD:143165 3/66 (5%)
FN3 1409..1498 CDD:238020 24/99 (24%)
FN3 1515..1588 CDD:238020 19/84 (23%)
PTPRQXP_016874762.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.