DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dscam2 and Kirrel3

Sequence 1:NP_001261500.1 Gene:Dscam2 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:XP_017451106.1 Gene:Kirrel3 RGDID:1311382 Length:784 Species:Rattus norvegicus

Alignment Length:711 Identity:176/712 (25%)
Similarity:273/712 (38%) Gaps:158/712 (22%)


  Fly   408 DTFQATAELQLGDAPPVLLYSFI----EQTLQPGPAVSLKCSAAGNPTPQ----ISWTLDGFPLP 464
            |.|:...|.|        :|||.    :|.:..|..|:|.|:     .|:    :.|..||..| 
  Rat    43 DKFRRMNEGQ--------VYSFSQQPQDQVVVSGQPVTLLCA-----IPEYDGFVLWIKDGLAL- 93

  Fly   465 SNGRFMIG--QYITVHGDVIS---HVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGLPYIR 524
            ..||.:..  ||:.| |:.:|   |:.|....::|...|.|.|...|.| ...|||.:...|...
  Rat    94 GVGRDLSSYPQYLVV-GNHLSGEHHLKILRAELQDDAVYECQAIQAAIR-SRPARLTVLVPPDDP 156

  Fly   525 LI---PKVTAVSGETLNLKCPV-AGYPIEEIHWERGGRE----------LPDDIRQRVQPDGSLT 575
            :|   |.::..:|:.|||.|.. ...|...|.|.|.|..          |.|..|:.:.  .:|.
  Rat   157 IILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRESIV--STLF 219

  Fly   576 ISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIV--PP--KLSPFQTNILQLNMGDRASLTCSV 636
            |||....:...: .|.|.||.....:.: .||:.:  ||  .||.....:|:.|:   .:..||.
  Rat   220 ISPGDVENGQSI-VCRATNKAIPGGKET-SVTIDIQHPPLVNLSVEPQPVLEDNI---VTFHCSA 279

  Fly   637 VKGDLPLTINWRKDGRPIDPTQHMSVKQV--DQYNSILVIENLGSDHTGNY-----SCVVRNSAA 694
            ..........|.|.|       |: :|:.  :.|.:.:       |:|  |     ||.|.|:..
  Rat   280 KANPAVTQYRWAKRG-------HI-IKEASGELYRTTV-------DYT--YFSEPVSCEVTNALG 327

  Fly   695 EVENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVW-KKATGSKSGEYEEVRER 758
            ....|:.:.|...||...||....|:.....:..|...|.|:.:||| |:.:|            
  Rat   328 STNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSG------------ 380

  Fly   759 PFTKLLGNGSLLLQHVKEDREGFYLCQA-NNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDT 822
              ..|....:|.|:.|:::..|.|:|:| ...:|.| .:.:.|.||..|..||| ::.....|:.
  Rat   381 --VVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAG-EREVTLTVNGPPIISST-QTQHALHGEK 441

  Fly   823 ALLQCAV-SGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATD-SGPYFC 885
            ..::|.: |...|..|.|... :|.|...|:.:.:|:...|.:||.:.|.|..:...| ...|.|
  Rat   442 GQIKCFIRSTPPPDRIAWSWK-ENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNC 505

  Fly   886 RASNLYGNDQQLVQLQVQEPPLPPSV-LEA---------------------------AMISSRSV 922
            .|.|.:|:|.::::|:.|...:.... |||                           |...:||.
  Rat   506 TAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQ 570

  Fly   923 -NIKWQPKTLGTGDVTKYIV-----EFREA-DHSLPPALFVDQWQ--------QIEV--KDPPHF 970
             |:|  .......|:...||     ..||| ||:....|.:|:.:        |:||  ::...|
  Rat   571 RNLK--GVVSAKNDIRVEIVHKEPASGREAEDHTTIKQLMMDRGEFQQDSVLKQLEVLKEEEKEF 633

  Fly   971 NAMIENLKPATR--YAFRVIAEGSAGRSAPSQELIVRTEPQRPAGP---PLSLSARPLSST 1026
                :|||..|.  |:.....|   ..|.|:..|.......||.|.   |..:|...:.||
  Rat   634 ----QNLKDPTNGYYSVNTFKE---HHSTPTISLSSCQPDLRPTGKQRVPTGMSFTNIYST 687

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352 4/10 (40%)
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653 28/94 (30%)
IGc2 436..507 CDD:197706 23/80 (29%)
I-set 521..610 CDD:254352 26/103 (25%)
IGc2 533..597 CDD:197706 21/75 (28%)
Ig 630..699 CDD:143165 15/76 (20%)
IG_like 714..802 CDD:214653 21/90 (23%)
Ig 725..802 CDD:299845 19/79 (24%)
Ig 823..894 CDD:143165 20/73 (27%)
FN3 906..1006 CDD:238020 31/147 (21%)
FN3 1013..1111 CDD:238020 5/18 (28%)
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Kirrel3XP_017451106.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.