DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and zig-4

DIOPT Version :9

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:225 Identity:52/225 - (23%)
Similarity:86/225 - (38%) Gaps:68/225 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 RLTVATPIQVEISPNVLSVHMGGTAEFRCLVTS----------NGSPVGMQNILWYKD-----GR 373
            ::.:..|::..:.|.      |.|.:.||.:.|          ||..:...|.|..::     |:
 Worm    45 KIKIVAPLESALIPG------GETYQLRCDIMSTPAATIHWKFNGKLIQGSNELNVEEKLLNFGK 103

  Fly   374 QLPSSGRVEDTLVVPRVSRENRGMYQCVVRRPEGDTFQATAELQL-GD----------APPVLLY 427
            .:..:|.|...|.:...|.||.|.|.||..... .|.:..||::: |:          ||.::.:
 Worm   104 AIVDTGIVASILTIQCPSAENSGTYSCVGYNGH-QTIETVAEVEIEGEASGCRSNHKSAPEIVFW 167

  Fly   428 --SFIEQTLQPGPAVSLKCSAAGNPTPQISWTL----------DGFPLPSNGRFMIGQYITVHGD 480
              |..|.|   |...:|.|.|    ..|:.|..          |.|.:.||            ||
 Worm   168 TDSRFEMT---GNVATLVCRA----NQQVDWVWMSNDELVKNNDKFTVLSN------------GD 213

  Fly   481 VISHVNISHVMVEDGGEYACIAENRAGRVQ 510
            ::    |.:::.:|.|.|.|||.|:.|..:
 Worm   214 LV----IKNIVWDDMGTYTCIARNQFGEAR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352 0/2 (0%)
Ig 247..327 CDD:299845 0/2 (0%)
I-set 332..418 CDD:254352 24/100 (24%)
IGc2 344..407 CDD:197706 20/77 (26%)
IG_like 432..517 CDD:214653 22/89 (25%)
IGc2 436..507 CDD:197706 20/80 (25%)
I-set 521..610 CDD:254352
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165
IG_like 714..802 CDD:214653
Ig 725..802 CDD:299845
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
zig-4NP_509335.1 I-set 47..147 CDD:254352 25/106 (24%)
Ig 65..144 CDD:143165 19/79 (24%)
IG_like 176..245 CDD:214653 21/84 (25%)
Ig <193..238 CDD:299845 15/60 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.