DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and zig-4

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:225 Identity:52/225 - (23%)
Similarity:86/225 - (38%) Gaps:68/225 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 RLTVATPIQVEISPNVLSVHMGGTAEFRCLVTS----------NGSPVGMQNILWYKD-----GR 373
            ::.:..|::..:.|.      |.|.:.||.:.|          ||..:...|.|..::     |:
 Worm    45 KIKIVAPLESALIPG------GETYQLRCDIMSTPAATIHWKFNGKLIQGSNELNVEEKLLNFGK 103

  Fly   374 QLPSSGRVEDTLVVPRVSRENRGMYQCVVRRPEGDTFQATAELQL-GD----------APPVLLY 427
            .:..:|.|...|.:...|.||.|.|.||..... .|.:..||::: |:          ||.::.:
 Worm   104 AIVDTGIVASILTIQCPSAENSGTYSCVGYNGH-QTIETVAEVEIEGEASGCRSNHKSAPEIVFW 167

  Fly   428 --SFIEQTLQPGPAVSLKCSAAGNPTPQISWTL----------DGFPLPSNGRFMIGQYITVHGD 480
              |..|.|   |...:|.|.|    ..|:.|..          |.|.:.||            ||
 Worm   168 TDSRFEMT---GNVATLVCRA----NQQVDWVWMSNDELVKNNDKFTVLSN------------GD 213

  Fly   481 VISHVNISHVMVEDGGEYACIAENRAGRVQ 510
            ::    |.:::.:|.|.|.|||.|:.|..:
 Worm   214 LV----IKNIVWDDMGTYTCIARNQFGEAR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 86..90 CDD:409353
Ig strand F 106..111 CDD:409353
Ig strand G 119..123 CDD:409353
V-set 138..229 CDD:462230
Ig 238..327 CDD:472250 0/2 (0%)
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 293..297 CDD:409353
Ig strand F 307..312 CDD:409353
Ig strand G 320..323 CDD:409353
Ig 330..418 CDD:472250 25/102 (25%)
Ig strand B 348..352 CDD:409353 0/3 (0%)
Ig strand C 365..369 CDD:409353 2/3 (67%)
Ig strand E 383..387 CDD:409353 1/3 (33%)
Ig strand F 397..402 CDD:409353 2/4 (50%)
Ig strand G 411..414 CDD:409353 0/2 (0%)
IgI_4_Dscam 422..517 CDD:409548 25/101 (25%)
Ig strand A 422..425 CDD:409548 1/2 (50%)
Ig strand A' 431..435 CDD:409548 2/3 (67%)
Ig strand B 438..447 CDD:409548 2/8 (25%)
Ig strand C 452..458 CDD:409548 2/5 (40%)
Ig strand C' 460..463 CDD:409548 1/2 (50%)
Ig strand D 468..476 CDD:409548 0/7 (0%)
Ig strand E 480..489 CDD:409548 2/8 (25%)
Ig strand F 496..504 CDD:409548 5/7 (71%)
Ig strand G 507..517 CDD:409548 1/4 (25%)
IgI_5_Dscam 521..608 CDD:409550
Ig strand A 521..523 CDD:409550
Ig strand A' 528..532 CDD:409550
Ig strand B 535..542 CDD:409550
Ig strand C 549..555 CDD:409550
Ig strand C' 556..558 CDD:409550
Ig strand D 565..569 CDD:409550
Ig strand E 572..578 CDD:409550
Ig strand F 586..594 CDD:409550
Ig strand G 598..608 CDD:409550
Ig 611..704 CDD:472250
Ig strand B 630..634 CDD:409353
Ig strand C 644..648 CDD:409353
Ig strand E 670..674 CDD:409353
Ig strand F 684..689 CDD:409353
Ig strand G 697..700 CDD:409353
IgI_7_Dscam 707..802 CDD:409546
Ig strand A 707..711 CDD:409546
Ig strand A' 716..720 CDD:409546
Ig strand B 723..732 CDD:409546
Ig strand C 738..744 CDD:409546
Ig strand C' 750..753 CDD:409546
Ig strand D 761..764 CDD:409546
Ig strand E 767..773 CDD:409546
Ig strand F 780..788 CDD:409546
Ig strand G 793..802 CDD:409546
Ig 806..892 CDD:472250
Ig strand B 823..827 CDD:409353
Ig strand C 836..840 CDD:409353
Ig strand E 868..872 CDD:409353
Ig strand F 882..887 CDD:409353
FN3 <904..1195 CDD:442628
FN3 906..1006 CDD:238020
fn3 1221..1306 CDD:394996
Ig 1336..1396 CDD:409353
Ig strand B 1336..1340 CDD:409353
Ig strand E 1371..1375 CDD:409353
Ig strand F 1385..1390 CDD:409353
FN3 <1407..>1606 CDD:442628
fn3 1408..1491 CDD:394996
zig-4NP_509335.1 Ig_3 47..134 CDD:464046 22/92 (24%)
IG_like 176..245 CDD:214653 21/84 (25%)
Ig strand B 179..183 CDD:409353 1/3 (33%)
Ig strand C 190..194 CDD:409353 1/3 (33%)
Ig strand E 212..216 CDD:409353 2/7 (29%)
Ig strand F 226..231 CDD:409353 2/4 (50%)
Ig strand G 240..243 CDD:409353 52/225 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.