DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dscam2 and syg-1

Sequence 1:NP_001261500.1 Gene:Dscam2 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_001123159.1 Gene:syg-1 WormBaseID:WBGene00006365 Length:730 Species:Caenorhabditis elegans

Alignment Length:611 Identity:136/612 (22%)
Similarity:223/612 (36%) Gaps:170/612 (28%)


  Fly   397 MYQCVVRRPEGDTFQATAELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGF 461
            :.|.:|..|: ||..|..|       ..:|...:|.  |.||               :.|..|.|
 Worm    21 LQQRIVEAPK-DTLAAVGE-------TAILTCRVEH--QQGP---------------VQWMKDDF 60

  Fly   462 --------PLPSNGRF-MIGQYITVHGDVISHVNISHVMVEDGGEYAC-IAENRAGR--VQHAAR 514
                    |||.|.|: |:|.  ..:|:.  ::.||:|.:.|..::|| |:|:...:  |...|:
 Worm    61 GLGTDRDKPLPGNKRYRMVGS--AANGEY--NLEISNVTLFDDDDFACQISESDHAKAVVSSKAK 121

  Fly   515 LNIYGLPYIRLIPKVT-------AVSGETLNLKC--------PVAGYPIEE-------IHW---- 553
            |.:...|   ..||:.       |::|:.:...|        |..|:.|..       :.|    
 Worm   122 LTVLVRP---TPPKIVKSHHSLKAIAGDPITQSCLSRKGKPPPTIGWAIASDEHGKHIVSWLGES 183

  Fly   554 --ERGGRELPDDIRQ-----------RVQPDGSLTISPVQKNSDSGVYTCWA------RNKQGH- 598
              :.||.....:|.|           :|:..|:      ....||.:|:..:      |.:..| 
 Worm   184 RSKFGGIHAKPEISQETVIAHVNETTQVEEGGN------NSREDSSIYSIMSNLSFIPRPEDDHK 242

  Fly   599 ----------------------SARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDL 641
                                  |.|.:.::.:.|..|| |.:.|       ..|.|.|:|....|
 Worm   243 YLICISQHMTFPNKIEVDSVKLSLRYAPQINLTVASKL-PLREN-------GSALLACNVNAKPL 299

  Fly   642 P-LTINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLG-SDHTGNYSCVVRNSAAEVENSQALLV 704
            . :.|:|.|..:.:..|           ...|..|.|. .||..:..|...|.......|..|.|
 Worm   300 DNVKISWYKGNQKLRET-----------GDTLTFETLKMEDHNRDIFCEATNEIGTTRGSIKLNV 353

  Fly   705 NVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNG-S 768
            ....|.:....|..|....:...||.....|.|:|.|.:      |:.:|:        :|:| :
 Worm   354 AFGARIMSTSQDKEVNEGDNAFFHCATLANPAPAIFWTR------GDSDEI--------IGHGEN 404

  Fly   769 LLLQHVKEDREGFYLCQANNGIGTGIGKVI---QLKVNSSPYFSSTSRSVMVKKGDTALLQCAVS 830
            |.|::|:..::|.|.|.|.   ..|..|.|   .|.:...|..|... .|.....:...:.|.:|
 Worm   405 LTLENVRTWQQGNYNCTAT---VEGFRKQILSHYLHIRGPPTVSMKD-EVSASLDEATEIICEIS 465

  Fly   831 G-DKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGND 894
            | .|..|:.|..:||. :| ..|.:|:|.|...|.|..:.|:|:.:...|.|.|.|.|:|..|.|
 Worm   466 GRPKTNNVRWTVNGKE-IN-FNNGRITVHQYPKPYGKESILKIKDLKEEDFGVYNCSANNGLGFD 528

  Fly   895 QQLVQLQVQEPPLPPSVLEAAMISSR 920
            .:...|:.:      ::|:..:|:::
 Worm   529 NRGTLLKKR------NILDWIVITAK 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352 7/21 (33%)
IGc2 344..407 CDD:197706 3/10 (30%)
IG_like 432..517 CDD:214653 25/97 (26%)
IGc2 436..507 CDD:197706 21/81 (26%)
I-set 521..610 CDD:254352 23/157 (15%)
IGc2 533..597 CDD:197706 16/102 (16%)
Ig 630..699 CDD:143165 16/71 (23%)
IG_like 714..802 CDD:214653 23/92 (25%)
Ig 725..802 CDD:299845 21/81 (26%)
Ig 823..894 CDD:143165 24/72 (33%)
FN3 906..1006 CDD:238020 2/16 (13%)
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
syg-1NP_001123159.1 I-set 24..124 CDD:254352 33/129 (26%)
Ig 30..124 CDD:299845 31/123 (25%)
Ig <151..265 CDD:299845 16/120 (13%)
Ig_2 276..353 CDD:290606 23/96 (24%)
IG_like 283..353 CDD:214653 19/88 (22%)
IG_like 363..427 CDD:214653 20/81 (25%)
Ig_2 368..438 CDD:290606 22/87 (25%)
Ig 440..528 CDD:299845 27/91 (30%)
IG_like 450..535 CDD:214653 27/87 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.