DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dscam2 and Dscam

Sequence 1:NP_001261500.1 Gene:Dscam2 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:NP_598271.1 Gene:Dscam RGDID:619992 Length:2013 Species:Rattus norvegicus

Alignment Length:2090 Identity:648/2091 (31%)
Similarity:1009/2091 (48%) Gaps:199/2091 (10%)


  Fly     1 MWISSRFFVILLLLNLDNTCSEPFEAHLRGPGFVMEPPGRVEFSNSSGGWLDCSASGSPQPTVDW 65
            |||    ..:.|..:..|..||...:.|.   ||......|.|:::||..:.|.|:|.|..|:.|
  Rat     1 MWI----LALSLFQSFANVFSEEPHSSLY---FVNASLQEVVFASTSGTLVPCPAAGIPPVTLRW 58

  Fly    66 VHADGSAVTEIHGVRRVLRNGTLVLMPFAAAAYHQDVHNTIYRCIASNSVGRIVSRDVQVRAVVA 130
            ..|.|..:.::.|:|.|..||||.:.||..:::...:|:..|.|.|.|..|:|.|:||.::||:.
  Rat    59 YLATGEEIYDVPGIRHVHPNGTLQIFPFPPSSFSTLIHDNTYYCTAENPSGKIRSQDVHIKAVLR 123

  Fly   131 QAYKVDVEVLSAARGCTAILRCVVPTFVKELVRVVSWVHEPAIYIYPSLQGDGKFHLLPTGELLI 195
            :.|.|.||.....||..|:.:|::|:.|:..|.||||..:..     ||....:|.:..||.|.|
  Rat   124 EPYTVRVEDQKTMRGNVAVFKCIIPSSVEAYVTVVSWEKDTV-----SLVSGSRFLITSTGALYI 183

  Fly   196 HNLQESDESQSFRCRSMHRLTRQVVVSSPTRLRI----NSHRGIISPSVVEHTAHVQVSQDEGAV 256
            .::|..|...::||.:.||.|.:...|:..||.:    ||     :||:::...|.:....:...
  Rat   184 KDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPANS-----APSILDGFDHRKAMAGQRVE 243

  Fly   257 LLCVAQGCPSPEYSWFTHNGAGPLPV-LSGPRVRLLGPILAIEAVTGEDSGVYKCTAGNVGGEAS 320
            |.|.|.|.|.|:|.|...|    :|: ||| |.:.....|.||.....|||.|.|...|..|.|.
  Rat   244 LPCKALGHPEPDYRWLKDN----MPLELSG-RFQKTVTGLLIENSRPSDSGSYVCEVSNRYGTAK 303

  Fly   321 AELRLTVATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILWYKDGRQLPSSGRVEDT- 384
            ...||.|..|::..|||..:...:|......|.||.|..    |.:.||::|..|.....|..| 
  Rat   304 VIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGNED----QELSWYRNGEILNPGKNVRITG 364

  Fly   385 -----LVVPRVSRENRGMYQCVVRRPEGDTFQATAELQ--LGDAPPVLLYSFIEQTLQPGPAVSL 442
                 |::..:.:.:.|.|||.||:   |...|...:|  |.|..|.::.:|.|:.:.|...|||
  Rat   365 LNHANLIMDHMVKSDGGAYQCFVRK---DKLSAQDYVQVVLEDGTPKIISAFSEKVVSPAEPVSL 426

  Fly   443 KCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAENRAG 507
            .|:..|.|.|.::||||..|:.......|.|.||..|:|:|::|||...|.|||.|.|.|.|.||
  Rat   427 VCNVKGTPLPTVTWTLDDDPILKGSGHRISQMITSEGNVVSYLNISSSQVRDGGVYRCTANNSAG 491

  Fly   508 RVQHAARLNIYGLPYIRLIPKVTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDIRQ-RVQPD 571
            .|.:.||:|:.|...||.:..:||::|....:.|.|.|||...|.|.:....||.:.|| ..:.:
  Rat   492 VVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNANLLPFNHRQVAFENN 556

  Fly   572 GSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSV 636
            |:|.:|.|||..|.|.|||....:...|..:|..|||.|||.:.||:  ..:.::|.|..:.|.|
  Rat   557 GTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFIQPFE--FPRFSIGQRVFIPCVV 619

  Fly   637 VKGDLPLTINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQA 701
            |.||||:||.|:||||||..:..:::..:| :.|.|.|.||...|.|||:|:.||.||.||:...
  Rat   620 VSGDLPITITWQKDGRPIPASLGVTIDNID-FTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQ 683

  Fly   702 LLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGN 766
            |:|.|||:::|:|.|.:....:.::|:|.|:|.|.|:||||.:.|:...:::.:......::|.|
  Rat   684 LIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSN 748

  Fly   767 GSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSG 831
            ||||::||.|:..|:|||:.:|.:|..:.|.:.|.|......:|...:.:..:|....:.|...|
  Rat   749 GSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPAMITSYPNTTLATQGQRKEMSCTAHG 813

  Fly   832 DKPINIVWMRSGKNTLNPS-TNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQ 895
            :|||.:.|.:..: .:||. ..|.:|.|:  ..:.|.:.|||......|||.:.|.|.|.||.|:
  Rat   814 EKPIIVRWEKEDR-IINPEMARYLVSTKE--VGEEVISTLQILPTVREDSGFFSCHAINSYGEDR 875

  Fly   896 QLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPALFVDQWQ 960
            .::||.|||||.||.: |...:.:|::.::|.....|...:|.|.:|.:...         |.|.
  Rat   876 GIIQLTVQEPPDPPEI-EIKDVKARTITLRWTMGFDGNSPITGYDIECKNKS---------DSWD 930

  Fly   961 QIE-VKD-PPHFN-AMIENLKPATRYAFRVIAEGSAGRSAPSQELIVRTEPQRPAGPPLSLSARP 1022
            ..: .|| .|..| |.|.::.|::.|:.|:.|:...|:|.||.|:.:..:...|.|||..:...|
  Rat   931 SAQRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKSEPSNEITITADEAAPDGPPQEVHLEP 995

  Fly  1023 LSSTELLISWVAPLPELRHGDIQGYNVGYK-LSSSGNTAYNFTSVSGDGDGGNGELLLSGLAKFA 1086
            .||..:.::|.||...|::|.|:||.:||: .|:.||..:|..|:...||  :....|..|.||.
  Rat   996 TSSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNFQFNIISIDTTGD--SEVYTLDNLNKFT 1058

  Fly  1087 RYTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRPPEDVRCAALSSQSLQVSWQPPPIYHTNGLLQG 1151
            :|.:||||.|:.|.||.|:.....|:|||||.|||:|:..|.|.:|:.:||........||:|||
  Rat  1059 QYGLVVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPESISISWSTLSKEALNGILQG 1123

  Fly  1152 YKLIF-EPIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQVLAHTRMGDGVVSKPLFCHSE 1215
            :::|: ..:||.   ...|:::..||..::.|.||.|||||||||||.||.||||.|:.:|..::
  Rat  1124 FRVIYWANLIDG---ELGEIKNVTTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTK 1185

  Fly  1216 EDVPEAPADIKVVSSSSQSLYISWLPPNEPNGVITKYSL-----YTRVVNGREELNNEKRSLPSQ 1275
            ||||..||.:|..::|:..:::|||||.:.||:|.||::     |..|:       :|..:.|..
  Rat  1186 EDVPGPPAGVKAAAASASMVFVSWLPPLKLNGIIRKYTVFCSHPYPTVI-------SEFEASPDS 1243

  Fly  1276 QAYYEAKGLHPHMEYQFWVTASTRVGEGKSSRVSSQITTNRIPARIISFGGPVVRPWRSTVTLPC 1340
            .: |....|..:.:|..||.|.|..|.|.||.:.:.....:.||||::|.|.|..||...:.|||
  Rat  1244 FS-YRIPNLSRNRQYSVWVVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPC 1307

  Fly  1341 TAVGKPKR--EWFKSDVALRQGGLHNSQLLD-------SGDLIISSLQLADGGNYSCQVDNGIGT 1396
            .|||.|..  :|.|.     ..|..:...:|       :|..:|.:::..|.|.|||..:|..|:
  Rat  1308 KAVGDPSPAVKWMKD-----SNGTPSLVTIDGRRSIFSNGSFVIRTVKAEDSGYYSCVANNNWGS 1367

  Fly  1397 DRLTHTLIVQVPPTAPVLYVTSATSSSILMHWKCGFTGNAPITGYTLFYRRANGNT-DEMQLSRH 1460
            |.:...|.|||||..|.|.|:..|||||.:.|..|..|.:.|.||.|.|...|... ....:|..
  Rat  1368 DEIILNLQVQVPPDQPRLTVSKTTSSSITLSWLPGDNGGSSIRGYILQYSEDNSEQWGSFPISPS 1432

  Fly  1461 ASSHELKGLMCGSTYQIHLSAQNKVGTSPTSTILHVRTQGQSPGHPASTALLAP-NSTSLLVRLH 1524
            ..|:.|:.|.||:.|:..|:|||.||....|.|:..:|.|:.|.......|.|. |:|.:.:.|.
  Rat  1433 ERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTRVRLNLI 1497

  Fly  1525 SWPDNGCPLLYFVLQYRAVTDDPDAEWVLVSNALKPQRRIVINNLQPSTLYQLRMEAHNVAGISQ 1589
            .|.|.|||:..|.|:||..   ....|. .:......:..::.:||.:|.|:|:|...|.||.::
  Rat  1498 GWNDGGCPITSFTLEYRPF---GTTVWT-TAQRTSLSKSYILYDLQEATWYELQMRVCNSAGCAE 1558

  Fly  1590 AEFNFVTLTKDGDPPPPEIMHRGRSGQTTVIFANINLLIPTIAAVSGMFCTIIMIIVCYRH---- 1650
            .:.||.||..||...||.|....:|.:.......:.:|:.....:.|:....::::|..|.    
  Rat  1559 KQANFATLNYDGSTIPPLIKSVVQSEEGLTTNEGLKILVTISCILVGVLLLFVLLLVVRRRRREQ 1623

  Fly  1651 ---MLKNAPPLAEQSQIQKESLENRANSEAAQRERYYATIHKVSMQNNDKIPETSEDISPYATFQ 1712
               .|::|..|||. .:.|.:..:...|:..|..|.:..|.:..:...::  :|.|.|...:|..
  Rat  1624 RLKRLRDAKSLAEM-LMSKNTRTSDTLSKQQQTLRMHIDIPRAQLLIEER--DTMETIDDRSTVL 1685

  Fly  1713 LSEAG-GNMSQPHHGGPANTLLHSFMYHERALAEG----CSSPPPAASKNRRRHSRKTEPESEES 1772
            |::|. |..::.    .:.|:.|:..|...:.|.|    .|...|..:...||:: |..|.:...
  Rat  1686 LTDADFGEAAKQ----KSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNA-KAGPTARNR 1745

  Fly  1773 ESDQ------------------------------DQLTSSRTESSNQHEGKIKHSIIYHGAQSST 1807
            .:.|                              |:.:.|.:.|.:|...:.:.|::...:.|||
  Rat  1746 YASQWTLNRPHPTISAHTLTTDWRLPTPRATGSVDKESDSYSVSPSQDTDRARSSMVSTESASST 1810

  Fly  1808 SSDLSPMSEQKSLPRRGRSRYHHQQYQFSTNTTPRHHNSNKMNNNTTSNTNT-TATNTTATPSTS 1871
            ..:|:...|...:         .:|.:.:..|......|:..:...|:.||. |.:.|::|||.|
  Rat  1811 YEELARAYEHAKM---------EEQLRHAKFTITECFISDTSSEQLTAGTNEYTDSLTSSTPSES 1866

  Fly  1872 SNSNKILSP----RGGNLKSISSTFKSQDSIQCHIPTLVK--------SPSIS-----------T 1913
            .......||    .||.:.:::.....:.....|:|..::        :|..|           .
  Rat  1867 GICRFTASPPKPQDGGRVVNMAVPKAHRPGDLIHLPPYLRMDFLLNRGAPGTSRDLSLGQACLEP 1931

  Fly  1914 QQQKQFHKQQLQNSSTNNSQHSSSNPNSSSLKQQQPLLIT-PKLHQLE-------ANGQELLGLD 1970
            |:.:...:..:...:...:..|:|:........||..:.| |:....|       ::.||.| ||
  Rat  1932 QKSRTLKRPTVLEPTPMEASSSTSSTREGQQSWQQGAVATLPQREGAELGQAAKMSSSQESL-LD 1995

  Fly  1971 G----IGNSP 1976
            .    .||:|
  Rat  1996 SRGHLKGNNP 2005

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 51..127 CDD:299845 27/76 (36%)
Ig 138..>203 CDD:299845 21/65 (32%)
I-set 238..327 CDD:254352 30/90 (33%)
Ig 247..327 CDD:299845 27/81 (33%)
I-set 332..418 CDD:254352 25/94 (27%)
IGc2 344..407 CDD:197706 19/69 (28%)
IG_like 432..517 CDD:214653 37/85 (44%)
IGc2 436..507 CDD:197706 32/71 (45%)
I-set 521..610 CDD:254352 32/90 (36%)
IGc2 533..597 CDD:197706 23/65 (35%)
Ig 630..699 CDD:143165 33/69 (48%)
IG_like 714..802 CDD:214653 30/88 (34%)
Ig 725..802 CDD:299845 28/77 (36%)
Ig 823..894 CDD:143165 23/72 (32%)
FN3 906..1006 CDD:238020 27/103 (26%)
FN3 1013..1111 CDD:238020 37/99 (37%)
FN3 1119..1209 CDD:238020 41/91 (45%)
FN3 1219..1313 CDD:238020 30/99 (30%)
Ig 1336..1402 CDD:143165 21/75 (28%)
FN3 1409..1498 CDD:238020 33/90 (37%)
FN3 1515..1588 CDD:238020 22/73 (30%)
DscamNP_598271.1 I-set 504..595 CDD:254352 32/91 (35%)
IGc2 518..575 CDD:197706 22/57 (39%)
I-set 596..686 CDD:254352 40/93 (43%)
IGc2 609..675 CDD:197706 31/67 (46%)
I-set 690..784 CDD:254352 32/94 (34%)
Ig7_DSCAM 707..784 CDD:143211 28/77 (36%)
IG_like 794..882 CDD:214653 27/91 (30%)
Ig 802..889 CDD:299845 33/90 (37%)
FN3 885..978 CDD:238020 28/103 (27%)
FN3 986..1083 CDD:238020 37/99 (37%)
FN3 1091..1184 CDD:238020 42/96 (44%)
FN3 1189..1278 CDD:238020 30/97 (31%)
IG_like 1302..1376 CDD:214653 22/79 (28%)
IGc2 1302..1366 CDD:197706 19/69 (28%)
FN3 1380..1470 CDD:238020 33/90 (37%)
FN3 1486..1555 CDD:238020 21/73 (29%)
Required for netrin-mediated axon repulsion of neuronal growth cones. {ECO:0000250|UniProtKB:Q9ERC8} 1616..2013 76/409 (19%)
Ig 15..115 CDD:299845 34/103 (33%)
IG 44..113 CDD:214652 24/69 (35%)
IG_like 236..310 CDD:214653 27/79 (34%)
IGc2 239..300 CDD:197706 23/66 (35%)
IG_like 320..400 CDD:214653 23/87 (26%)
IGc2 328..388 CDD:197706 18/64 (28%)
IG_like 417..501 CDD:214653 37/84 (44%)
Ig 424..493 CDD:143165 32/69 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 964 1.000 Inparanoid score I302
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001376
OrthoInspector 1 1.000 T131060
orthoMCL 1 0.900 OOG5_128592
Panther 1 1.100 O PTHR10075
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
109.830

Return to query results.
Submit another query.