DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and ACBD6

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_115736.1 Gene:ACBD6 / 84320 HGNCID:23339 Length:282 Species:Homo sapiens


Alignment Length:87 Identity:26/87 - (29%)
Similarity:37/87 - (42%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EEATELANKFTKK----------PTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSS 59
            ||.:.||..|.|.          .:..:.|..|..:||..||:.|..||.....:.|.|:|||.:
Human    37 EETSCLAELFEKAAAHLQGLIQVASREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKA 101

  Fly    60 NKGLSKEAAKEAYVKVYEKYAP 81
            ....|...|.:.|:.|.:|..|
Human   102 LGDSSPSQAMQEYIAVVKKLDP 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 26/87 (30%)
ACBD6NP_115736.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
ACBP 43..118 CDD:459982 20/74 (27%)
ANKYR <166..>261 CDD:440430
ANK repeat 191..222 CDD:293786
ANK 1 191..220
ANK repeat 224..255 CDD:293786
ANK 2 224..253
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.