powered by:
                  
 
    
 
    
             
          
            Protein Alignment Acbp3 and ACBD6
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001163366.1 | 
            Gene: | Acbp3 / 38783 | 
            FlyBaseID: | FBgn0250836 | 
            Length: | 84 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_115736.1 | 
            Gene: | ACBD6 / 84320 | 
            HGNCID: | 23339 | 
            Length: | 282 | 
            Species: | Homo sapiens | 
          
        
        
        
          
            | Alignment Length: | 87 | 
            Identity: | 26/87 - (29%) | 
          
          
            | Similarity: | 37/87 -  (42%) | 
            Gaps: | 10/87 - (11%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly     5 EEATELANKFTKK----------PTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSS 59 
            ||.:.||..|.|.          .:..:.|..|..:||..||:.|..||.....:.|.|:|||.: 
Human    37 EETSCLAELFEKAAAHLQGLIQVASREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKA 101 
 
  Fly    60 NKGLSKEAAKEAYVKVYEKYAP 81 
            ....|...|.:.|:.|.:|..| 
Human   102 LGDSSPSQAMQEYIAVVKKLDP 123 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            1 | 
            0.900 | 
            - | 
            - | 
             | 
            E1_COG4281 | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | User_Submission | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            2 | 1.810 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.