DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp3 and ACBD6

Sequence 1:NP_001163366.1 Gene:Acbp3 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_115736.1 Gene:ACBD6 HGNCID:23339 Length:282 Species:Homo sapiens

Alignment Length:87 Identity:26/88 (30%)
Similarity:37/88 (42%) Gaps:10/88 (11%)


  Fly     5 EEATELANKFTKK----------PTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSS 59
            ||.:.||..|.|.          .:..:.|..|..:||..||:.|..||.....:.|.|:|||.:
Human    37 EETSCLAELFEKAAAHLQGLIQVASREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKA 101

  Fly    60 NKGLSKEAAKEAYVKVYEKYAP 81
            ....|...|.:.|:.|.:|..|
Human   102 LGDSSPSQAMQEYIAVVKKLDP 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp3NP_001163366.1 ACBP 4..84 CDD:294152 26/88 (30%)
ACBD6NP_115736.1 ACBP 44..123 CDD:307165 21/79 (27%)
Acyl-CoA binding. {ECO:0000250} 69..73 1/4 (25%)
ANK 165..261 CDD:238125
ANK repeat 191..222 CDD:293786
ANK 1 191..220
ANK repeat 224..255 CDD:293786
ANK 2 224..253
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.