DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and ACBP3

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001119041.1 Gene:ACBP3 / 828524 AraportID:AT4G24230 Length:366 Species:Arabidopsis thaliana


Alignment Length:58 Identity:20/58 - (34%)
Similarity:31/58 - (53%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAAKEAYVKVYEKYAP 81
            :|.:||.|.||.|.....:|.|:.:..:||:.||.....:|:|.|.|.|:.:..|..|
plant   257 MELFGLHKIATEGSCREAQPMAVMISARAKWNAWQKLGNMSQEEAMEQYLALVSKEIP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 20/58 (34%)
ACBP3NP_001119041.1 ACBP 232..309 CDD:459982 18/51 (35%)

Return to query results.
Submit another query.