DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and ACBP3

DIOPT Version :8

Sequence 1:NP_001163366.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001119041.1 Gene:ACBP3 / 828524 AraportID:AT4G24230 Length:366 Species:Arabidopsis thaliana

Alignment Length:58 Identity:20/59 (34%)
Similarity:31/59 (53%) Gaps:0/59 (0%)


  Fly    24 LEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAAKEAYVKVYEKYAP 81
            :|.:||.|.||.|.....:|.|:.:..:||:.||.....:|:|.|.|.|:.:..|..|
plant   257 MELFGLHKIATEGSCREAQPMAVMISARAKWNAWQKLGNMSQEEAMEQYLALVSKEIP 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp3NP_001163366.1 ACBP 4..84 CDD:294152 20/59 (34%)
ACBP3NP_001119041.1 ACBP 232..314 CDD:279259 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23310
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.