DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and Acbd5

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001342566.1 Gene:Acbd5 / 74159 MGIID:1921409 Length:520 Species:Mus musculus


Alignment Length:79 Identity:28/79 - (35%)
Similarity:43/79 - (54%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTK----KPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLS 64
            ||.|.::.....|    :||:...|:||..:||||.|...:.:||......:.|::||||...::
Mouse    48 FEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMT 112

  Fly    65 KEAAKEAYVKVYEK 78
            ||.|..|||:..:|
Mouse   113 KEEAMIAYVEEMKK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 28/79 (35%)
Acbd5NP_001342566.1 ACBP 45..132 CDD:238248 28/79 (35%)

Return to query results.
Submit another query.