DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and Acbd6

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_082526.2 Gene:Acbd6 / 72482 MGIID:1919732 Length:282 Species:Mus musculus


Alignment Length:78 Identity:23/78 - (29%)
Similarity:34/78 - (43%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAA 68
            ||:|........:..:..:.|..|..|||..||:.|..||.....:.|.|:|||.:....|...|
Mouse    46 FEKAAAHVQGLVQVASREQLLYLYARFKQVKVGNCNTPKPNFFDFEGKQKWEAWKALGDSSPSQA 110

  Fly    69 KEAYVKVYEKYAP 81
            .:.|:...:|..|
Mouse   111 MQEYIAAVKKLDP 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 23/78 (29%)
Acbd6NP_082526.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
ACBP 43..118 CDD:459982 21/71 (30%)
ANKYR <166..282 CDD:440430
ANK repeat 191..222 CDD:293786
ANK 1 191..220
ANK repeat 224..255 CDD:293786
ANK 2 224..253
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.