DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp3 and Acbd4

Sequence 1:NP_001163366.1 Gene:Acbp3 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_080264.1 Gene:Acbd4 MGIID:1914381 Length:329 Species:Mus musculus

Alignment Length:83 Identity:25/84 (30%)
Similarity:41/84 (49%) Gaps:4/84 (5%)


  Fly     4 FEEATELANKFTK----KPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLS 64
            |:.|..:.....|    :|:..|.|.||..:||||:|...:.:||......:.|::||:....:|
Mouse    14 FQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNRLGKMS 78

  Fly    65 KEAAKEAYVKVYEKYAPK 82
            :|.|..||:...:..|.|
Mouse    79 REEAMSAYISEMKLVAQK 96

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp3NP_001163366.1 ACBP 4..84 CDD:294152 25/84 (30%)
Acbd4NP_080264.1 ACBP 11..91 CDD:279259 23/77 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.