DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp3 and eci2

Sequence 1:NP_001163366.1 Gene:Acbp3 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001002645.3 Gene:eci2 ZFINID:ZDB-GENE-040718-392 Length:392 Species:Danio rerio

Alignment Length:70 Identity:29/71 (41%)
Similarity:40/71 (56%) Gaps:0/71 (0%)


  Fly     4 FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAA 68
            |.:|.:..|...|.|.:...|:.|.||||||||..|..|||.|...:|.|::||.....:|:|.|
Zfish    43 FNKAKDKLNTLKKDPGNEVKLKIYALFKQATVGPCNTPKPGMLDFVNKVKWDAWKGLGSISQEEA 107

  Fly    69 KEAYV 73
            ::.||
Zfish   108 RQQYV 112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp3NP_001163366.1 ACBP 4..84 CDD:294152 29/71 (41%)
eci2NP_001002645.3 ACBP 39..123 CDD:238248 29/71 (41%)
crotonase-like 140..387 CDD:329030
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.