DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and ACBD7

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001034933.1 Gene:ACBD7 / 414149 HGNCID:17715 Length:88 Species:Homo sapiens


Alignment Length:80 Identity:40/80 - (50%)
Similarity:49/80 - (61%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAA 68
            |:.|.|...|...:|.|.|..|.|||:|||.|||:||..||.|.||.|||:|||:..||||.|.|
Human     7 FDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDA 71

  Fly    69 KEAYVKVYEKYAPKY 83
            ..||:...::...||
Human    72 TSAYISKAKELIEKY 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 40/80 (50%)
ACBD7NP_001034933.1 ACBP 3..87 CDD:469667 40/80 (50%)

Return to query results.
Submit another query.