DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp3 and Acbp2

Sequence 1:NP_001163366.1 Gene:Acbp3 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_523952.2 Gene:Acbp2 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster

Alignment Length:86 Identity:45/87 (52%)
Similarity:55/87 (63%) Gaps:2/87 (2%)


  Fly     1 MVS--FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGL 63
            |||  |..|.|.....||:|:|.|||:.|.|||||:|||.:..|||.|.||.|||:|||:..||.
  Fly     1 MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGK 65

  Fly    64 SKEAAKEAYVKVYEKYAPKYA 84
            |.|||::.|:...|....|||
  Fly    66 SSEAAQQEYITFVEGLVAKYA 86

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp3NP_001163366.1 ACBP 4..84 CDD:294152 41/80 (51%)
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 43/84 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 P PTHR23310
RoundUp 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.