DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp3 and Acbp4

Sequence 1:NP_001163366.1 Gene:Acbp3 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_648081.1 Gene:Acbp4 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster

Alignment Length:84 Identity:70/85 (82%)
Similarity:77/85 (91%) Gaps:0/85 (0%)


  Fly     1 MVSFEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSK 65
            |||||||.|||..|:|||||:|||||||||||||||||||:|||.|.||.||.||||:::|||||
  Fly     1 MVSFEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSK 65

  Fly    66 EAAKEAYVKVYEKYAPKYA 84
            :||||||||||||||||||
  Fly    66 DAAKEAYVKVYEKYAPKYA 84

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp3NP_001163366.1 ACBP 4..84 CDD:294152 66/80 (83%)
Acbp4NP_648081.1 ACBP 4..81 CDD:279259 63/77 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131200934
eggNOG 1 0.900 E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588000at2759
OrthoFinder 1 1.000 FOG0000643
orthoMCL 1 0.900 OOG5_127366
Panther 1 1.100 P PTHR23310
RoundUp 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.