powered by:
Protein Alignment Acbp3 and Eci2
DIOPT Version :9
| Sequence 1: | NP_001163366.1 |
Gene: | Acbp3 / 38783 |
FlyBaseID: | FBgn0250836 |
Length: | 84 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001006967.1 |
Gene: | Eci2 / 291075 |
RGDID: | 1359427 |
Length: | 391 |
Species: | Rattus norvegicus |
| Alignment Length: | 70 |
Identity: | 27/70 - (38%) |
| Similarity: | 37/70 - (52%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAA 68
||.|........|.|.:...|..|.|:||||.|...:.|||.....:|||::||::...|.||.|
Rat 41 FENAMNQVKLLKKDPGNEVKLRLYALYKQATEGPCTMPKPGVFDFVNKAKWDAWNALGSLPKETA 105
Fly 69 KEAYV 73
::.||
Rat 106 RQNYV 110
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.