DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acbp3 and ECI2

Sequence 1:NP_001163366.1 Gene:Acbp3 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_996667.2 Gene:ECI2 HGNCID:14601 Length:394 Species:Homo sapiens

Alignment Length:78 Identity:30/79 (38%)
Similarity:44/79 (56%) Gaps:0/79 (0%)


  Fly     4 FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAA 68
            ||.:........|.|.:...|:.|.|:||||.|..|:.|||...|.:|||::||::...|.||||
Human    43 FENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALGSLPKEAA 107

  Fly    69 KEAYVKVYEKYAP 81
            ::.||.:....:|
Human   108 RQNYVDLVSSLSP 120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acbp3NP_001163366.1 ACBP 4..84 CDD:294152 30/79 (38%)
ECI2NP_996667.2 ACBP 40..113 CDD:279259 29/70 (41%)
Acyl-CoA binding. {ECO:0000250} 66..70 2/4 (50%)
crotonase-like 142..335 CDD:119339
ECH-like 151..322
Substrate binding. {ECO:0000250|UniProtKB:Q05871} 198..202
Microbody targeting signal. {ECO:0000255} 392..394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.