DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and eci2

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_012819853.2 Gene:eci2 / 100216270 XenbaseID:XB-GENE-961246 Length:413 Species:Xenopus tropicalis


Alignment Length:72 Identity:28/72 - (38%)
Similarity:41/72 - (56%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAA 68
            ||:|..........|.:...|:.|.||||||.|..|:.|||.|...:|.|::||.|...|.|:.|
 Frog    63 FEKAQSNLKLLKNDPGNEVKLKLYALFKQATQGPCNVPKPGMLDFVNKVKWDAWKSLGSLPKDDA 127

  Fly    69 KEAYVKV 75
            :::||::
 Frog   128 RQSYVEL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 28/72 (39%)
eci2XP_012819853.2 ACBP 60..131 CDD:469667 26/67 (39%)
crotonase-like 161..411 CDD:474030
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.