DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and acbd5b

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_005171195.1 Gene:acbd5b / 100004736 ZFINID:ZDB-GENE-070705-18 Length:425 Species:Danio rerio


Alignment Length:78 Identity:26/78 - (33%)
Similarity:36/78 - (46%) Gaps:10/78 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTKKPTDAEF-------LEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNK 61
            ||.|.::....   |.|..:       :.||..:||||.|..|..||.:.....|||:|||....
Zfish    16 FEAAVKVIRSL---PEDGSYDLSDDMLVLFYSYYKQATEGPCNTLKPNSWDPIGKAKWEAWKDLG 77

  Fly    62 GLSKEAAKEAYVK 74
            .:||:.|...||:
Zfish    78 NMSKDQAMTEYVQ 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 26/78 (33%)
acbd5bXP_005171195.1 ACBP 12..100 CDD:469667 26/78 (33%)

Return to query results.
Submit another query.