DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: msl-3 and Arid4b

Sequence 1:NP_523951.1 Gene:msl-3 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_919238.1 Gene:Arid4b MGIID:2137512 Length:1314 Species:Mus musculus

Alignment Length:369 Identity:73/370 (20%)
Similarity:122/370 (33%) Gaps:121/370 (33%)


  Fly   170 KGNRGRQTETFYNNAINDVSVYNHVPQEDRIMMRVSERLRELIEYDRNMIKV-------LGKQHA 227
            |.||||::              ||:|:|:.......:...|..:.|..:.||       |.|:.|
Mouse   139 KTNRGRRS--------------NHIPEEESSSSSSDDDEEERKQTDELLGKVVCVDYVSLEKKKA 189

  Fly   228 L--PARVPIVTIMENFVKQQAVELAISIKQDSSRARNTQS-------RNARMEREYDRVMSTVCM 283
            :  ||.|......:.          |::|:|:...|:.:.       |....|...|.|.....:
Mouse   190 MWFPALVVCPDCSDE----------IAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTVPKPDAV 244

  Fly   284 LKEVVDGLRIYFEFHVDDHLLYTEEKEYVHNYLTDDNMRNCSLILNKSYEYINPSGDTELIGLDG 348
            ||:..|..   .|||                       ::.::..|...|....|..:|     .
Mouse   245 LKQAFDQA---LEFH-----------------------KSRAIPANWKTELKEDSSSSE-----A 278

  Fly   349 TPVVEGSGDTNGQIGVINIGGPEYEKQLQKCLLYIVTASGKNTAQAYERTSPYTAAYKLPVEMRG 413
            ....|...|             |.||:             .|:::..|...|:      |.|...
Mouse   279 EEEEEEEDD-------------EKEKE-------------DNSSEEEEEIEPF------PEEREN 311

  Fly   414 FLNETFKWRLLSAESPPEKSMVFGAPH-----LVRLMIKMPMF--LNASPISNKKLEDL-LPHLD 470
            ||.:.:|: :....:|..|..|.|..:     |.||:.|:..|  :.:..:..:..:|| :|.|:
Mouse   312 FLQQLYKF-MEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLGIPVLN 375

  Fly   471 ---------AFINYLENHREWFDRENFVNSTALPQEDLQRELLD 505
                     |:..||....|:....|.....|||::.|.:...|
Mouse   376 SAAGYNVKCAYKKYLYGFEEYCRSANIDFQMALPEKVLNKPCKD 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390 59/323 (18%)
Arid4bNP_919238.1 TUDOR 58..113 CDD:197660
RBB1NT 169..262 CDD:285392 23/129 (18%)
ARID 311..394 CDD:198082 19/84 (23%)
Tudor-knot 571..624 CDD:288553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.