DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: msl-3 and AT4G37280

Sequence 1:NP_523951.1 Gene:msl-3 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_568021.1 Gene:AT4G37280 AraportID:AT4G37280 Length:320 Species:Arabidopsis thaliana

Alignment Length:474 Identity:86/475 (18%)
Similarity:145/475 (31%) Gaps:202/475 (43%)


  Fly    10 LFHKGEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRCVRATVLLK 74
            ||.:||.||.|...:     :|.:||..|..|:.|     ::|.:|:.||..::|..|.|..|||
plant    28 LFSEGERVLAYHGPR-----VYGAKVQKVELRKKE-----WKYFVHYLGWNKNWDEWVSADRLLK 82

  Fly    75 DTEENRQLQRELAEAAKLQIRGDYSYKGTPDKPSAKKKRGGKAAHVEEPIVVPMDTGHLEAEHEM 139
            .||||...|:.|.:...::       |||....||:.|....|           ||         
plant    83 HTEENLVKQKALDKKQGVE-------KGTKSGRSAQTKTRSSA-----------DT--------- 120

  Fly   140 APTPRAAGNRTRDNSGGKRKEKPPSGDGRLKGNRGRQTETFYNNAINDVSVYNHVPQEDRIMMRV 204
                :|..:.|:.|:...:|.|..||:.:                       ::|..|..:.:::
plant   121 ----KADKDDTKTNAAKGKKRKHESGNEK-----------------------DNVTAEKLMKIQI 158

  Fly   205 SERLRELIEYDRNMIKVLGKQHALPARVPIVTIMENFVKQQAVELAISIKQDSSRARNTQSRNAR 269
            ...|::.:..|...|....|...||....:..|:..:       |....|:|.            
plant   159 PASLKKQLTDDWEYIAQKDKVVKLPRSPNVDEILSKY-------LEFKTKKDG------------ 204

  Fly   270 MEREYDRVMSTVCMLKEVVDGLRIYFEFHVDDHLLYTEEKEYVHNYLTDDNMRNCSLILNKSYEY 334
                  .|..:|.   |::.|:|.||:..:...|||.:|:......:.||               
plant   205 ------MVTDSVA---EILKGIRSYFDKALPVMLLYKKERRQYQESIVDD--------------- 245

  Fly   335 INPSGDTELIGLDGTPVVEGSGDTNGQIGVINIGGPEYEKQLQKCLLYIVTASGKNTAQAYERTS 399
                                                                           ||
plant   246 ---------------------------------------------------------------TS 247

  Fly   400 PYTAAYKLPVEMRGFLNETFKWRLLSAESPPEKSMVFGAPHLVRLMIKMPMFLNASPISNKKLED 464
            |                                |.|:||.||:||.:|:|...:...:..:....
plant   248 P--------------------------------STVYGAEHLLRLFVKLPDLFSYVNMEEETWSR 280

  Fly   465 LLPHLDAFINYLENHREWF 483
            :...|..|:.:::.::..|
plant   281 MQQTLSDFLKFIQKNQSTF 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390 40/289 (14%)
AT4G37280NP_568021.1 Tudor-knot 31..82 CDD:288553 20/61 (33%)
MRG 135..299 CDD:283390 44/325 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10880
Phylome 1 0.910 0.667 Consistency score
33.020

Return to query results.
Submit another query.