DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: msl-3 and arid4b

Sequence 1:NP_523951.1 Gene:msl-3 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:XP_004914677.1 Gene:arid4b XenbaseID:XB-GENE-1003570 Length:1267 Species:Xenopus tropicalis

Alignment Length:307 Identity:59/308 (19%)
Similarity:108/308 (35%) Gaps:83/308 (27%)


  Fly     2 TELRDETPLFHKGEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYE--------------Y 52
            ||..|..    :||....| |...|.:|.|.       ..:|:   :.||              |
 Frog   542 TENEDSA----EGEEFESY-PSGMKVQVRYG-------RGKNQ---KLYEASVKDSDVEGGEVLY 591

  Fly    53 KIHFQGWRPSYDRCVRATVLLKDTEENRQLQRELAEAAKLQIRGDYSYKGTPDKPSAKKKRGGKA 117
            .:|:.||...||..::|..:::..:::   ..::....|::.:.::..|...|:.|.|..|    
 Frog   592 LVHYCGWNVRYDEWIKADKIVRPADKS---VPKIKHRKKIKNKLEHRDKSERDECSPKHCR---- 649

  Fly   118 AHVEEPIVVPMDTGHLEAE--------------HEMAP-TPRAAGNRTRDNSGGKRKEKPPSGDG 167
             ....|:..|.|   ||.|              |.|.. |....|.:..:||.    |...:...
 Frog   650 -LFPRPLFQPRD---LENESIQDDPENKHSLQGHTMVEITSILNGLQAAENSA----EDSETDHS 706

  Fly   168 RLKGNRGRQTETFYNNAINDVSVYNHVPQEDRIMMRVSERLRELIEYDRNMIKVLGKQHAL---P 229
            .|  |..::.:.|:         .||:..:      :::||.|...:........|....|   |
 Frog   707 SL--NMDKEEKAFH---------MNHISYD------INQRLDENKSFPLTEGNCTGLDPILAVIP 754

  Fly   230 ARVPIVTIMENFVKQQAVELAISIKQDSSRARN--TQSRNARMEREY 274
            ....::..:|:  .....:..:...:.|...:|  |:|:|.|.:|:|
 Frog   755 RSPDLLKTVED--SSDDTDYEVESARQSKYLKNDITKSQNKRGKRKY 799

Known Domains:


GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390 15/85 (18%)
arid4bXP_004914677.1 TUDOR 77..132 CDD:197660
RBB1NT 188..277 CDD:285392
ARID 321..407 CDD:198082
Tudor-knot 559..611 CDD:288553 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.