DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: msl-3 and arid4a

Sequence 1:NP_523951.1 Gene:msl-3 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:XP_005158686.1 Gene:arid4a ZFINID:ZDB-GENE-050809-105 Length:1332 Species:Danio rerio

Alignment Length:188 Identity:41/189 (22%)
Similarity:65/189 (34%) Gaps:55/189 (29%)


  Fly    19 CYEPDKS----KARVLY----TSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRCVRATVLL-- 73
            |.:.:.|    |.||.|    |.|:.....:..|.......|.:|:.||...||..|:|..::  
Zfish   592 CEDSEHSLAGTKVRVKYGKGKTQKIYEANIKNTETDDGEVLYLVHYYGWNVRYDEWVKADRIIWP 656

  Fly    74 ----------KDTEENRQLQRELAEAAKLQI---RGDYSYKGTPDKPSAKKKRGGKAAHVEEPIV 125
                      |...:|::.:.:..|..|.::   ||....|.||  |...:|             
Zfish   657 VDKGGTKKKQKKKVKNKEDEEKEKEEDKTKVVVRRGRPPLKSTP--PGTSRK------------- 706

  Fly   126 VPMDTGHLEAEHEMAPTPRAAGNRTRDNSGGKRKEKPPSGDGRLKGNRGRQTETFYNN 183
                            ||.:.|..:..||........|:|||..: .|.|:|...|::
Zfish   707 ----------------TPSSEGRSSSKNSRPTDASALPNGDGTPR-RRTRRTSGMYDS 747

Known Domains:


GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390
arid4aXP_005158686.1 TUDOR 58..113 CDD:295375
RBB1NT 171..260 CDD:285392
ARID 311..396 CDD:198082
Tudor-knot 601..654 CDD:288553 15/53 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.