DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: msl-3 and LOC102547271

Sequence 1:NP_523951.1 Gene:msl-3 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:XP_006256909.1 Gene:LOC102547271 RGDID:7702890 Length:84 Species:Rattus norvegicus

Alignment Length:79 Identity:23/80 (29%)
Similarity:39/80 (49%) Gaps:4/80 (5%)


  Fly   197 EDRIMMRVSERLRELIEYDRNMIKVLGKQHALPARVPIVTIMENFVKQQAVELAISIKQDSSRAR 261
            |..|.:.:.|.|::.:|.|...|....:...||.:..|:||:|::||..|:..|.|..:   |.|
  Rat     3 ERTITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITILESYVKHFAINAAFSANE---RPR 64

  Fly   262 NTQS-RNARMEREY 274
            :..: .:|.|...|
  Rat    65 HHHAMMHAHMNVHY 78

Known Domains:


GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390 23/80 (29%)
LOC102547271XP_006256909.1 MRG 1..>64 CDD:283390 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 1 1.000 FOG0004566
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.