DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: msl-3 and arid4b

Sequence 1:NP_523951.1 Gene:msl-3 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster
Sequence 2:XP_005173089.1 Gene:arid4b ZFINID:ZDB-GENE-160607-1 Length:1240 Species:Danio rerio

Alignment Length:251 Identity:50/252 (20%)
Similarity:80/252 (32%) Gaps:89/252 (35%)


  Fly    11 FHKGEIVLCYEPDKSKARVLY-TSKVLNVFERR-NEHGLRFYE--YKIHFQGWRPSYDRCVRATV 71
            :.:|:...||.|. .|.:|.| ..:.|..::.. .|..|...|  |.:|:.||...||..::|..
Zfish   532 WEEGQEFECYPPG-MKVQVRYGRGRSLKTYDATVKESNLEGGEVLYLVHYCGWNVRYDEWIKADK 595

  Fly    72 LLKDTEEN----------------------RQLQRELAEAAKLQIR--------GDYSYK----- 101
            :::...:|                      |...||...::|.:|.        ||...|     
Zfish   596 IVRPANKNVPKIKHRKKIKNKAERERDRIERLADREDLPSSKNRINRLSKVNSGGDVFSKMEECV 660

  Fly   102 ---------------GTP-----------------------DKPSAKKKRGGKAAHVEE---PIV 125
                           |.|                       |.|.|.|....::.|.|:   |..
Zfish   661 DKGNQQSIEITSILNGLPGSDSSTDDSEREEDEDADHDEDDDHPGAHKADPPQSQHWEKNSSPPE 725

  Fly   126 VPMDTGHLEAEHEMAPTPRAAGNRTRDN--SGGKRKE-----KPPSGDGRLKGNRG 174
            .|......|.|..:..:..|...:..|.  |.|:||:     |.|: .|:.:.:||
Zfish   726 APKTPADAEQEPTLQDSTEAPKRKELDTDASAGRRKKAENTSKSPA-KGKTRNSRG 780

Known Domains:


GeneSequenceDomainRegion External IDIdentity
msl-3NP_523951.1 MRG 196..486 CDD:283390
arid4bXP_005173089.1 TUDOR 60..109 CDD:197660
RBB1NT 170..264 CDD:285392
ARID 309..394 CDD:198082
Tudor-knot 543..596 CDD:288553 15/54 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.