DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Lcp65Ab2

DIOPT Version :8

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster

Alignment Length:106 Identity:31/106 - (29%)
Similarity:49/106 - (46%) Gaps:14/106 - (13%)


  Fly     3 KFFVLAVAALAVSCVQADSFDARAETREYKSDLKEDGSYAYQYQTSNGIAGQESGVGGYYASGSN 67
            ||.::.||..|::..:.:    .||.....||: |...::...:||:|.:.::.||.....:.:.
  Fly     2 KFLIVFVALFAMAVARPN----LAEIVRQVSDV-EPEKWSSDVETSDGTSIKQEGVLKNAGTDNE 61

  Fly    68 AYYA---------PDGQLIQLTYTADSNGYHPAGAHLPTPP 99
            |...         ..|:...:||.||.|||.|.|||||..|
  Fly    62 AAVVHGSFTWVDEKTGEKFTITYVADENGYQPQGAHLPVAP 102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 12/55 (22%)
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:306811 12/50 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.