DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Cpr97Ea

DIOPT Version :9

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster


Alignment Length:94 Identity:27/94 - (28%)
Similarity:45/94 - (47%) Gaps:12/94 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VQADSFDARAETREYKSD----LK------EDGSYAYQYQTSNGIAGQESGVGGYYASGSNAYYA 71
            ::|::..||||..  ::|    ||      |||||.|.|:.::|....|:.:......|...|..
  Fly    40 LRANAAPARAEAP--RADPVAILKQINKHNEDGSYTYGYEGADGSFKIETKLATGEVKGKYGYVD 102

  Fly    72 PDGQLIQLTYTADSNGYHPAGAHLPTPPP 100
            ..|::..:.|.|:..|:.|:|..:...||
  Fly   103 ETGKVRVVEYGANKYGFQPSGEGITVAPP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 10/46 (22%)
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791 10/46 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.