DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Cpr97Ea

DIOPT Version :10

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster


Alignment Length:94 Identity:27/94 - (28%)
Similarity:45/94 - (47%) Gaps:12/94 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VQADSFDARAETREYKSD----LK------EDGSYAYQYQTSNGIAGQESGVGGYYASGSNAYYA 71
            ::|::..||||..  ::|    ||      |||||.|.|:.::|....|:.:......|...|..
  Fly    40 LRANAAPARAEAP--RADPVAILKQINKHNEDGSYTYGYEGADGSFKIETKLATGEVKGKYGYVD 102

  Fly    72 PDGQLIQLTYTADSNGYHPAGAHLPTPPP 100
            ..|::..:.|.|:..|:.|:|..:...||
  Fly   103 ETGKVRVVEYGANKYGFQPSGEGITVAPP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 10/46 (22%)
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 10/46 (22%)

Return to query results.
Submit another query.