DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Cpr78Cb

DIOPT Version :9

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001262144.1 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster


Alignment Length:133 Identity:47/133 - (35%)
Similarity:69/133 - (51%) Gaps:26/133 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FVLAVAALAVSCVQADSFDAR---------AETREYK------SDLKEDGSYAYQYQTSNGIAGQ 54
            |::.:..||:..|:.|:...|         |..|:.:      |...::|.:.|.::|||||..|
  Fly     4 FLIGMVLLALIWVEVDARLVRVRRIRRLVGASERDARITDFRVSPTDDEGVFKYAFKTSNGIDVQ 68

  Fly    55 ESG-----VGGYYASGSNAYYAPDGQLIQLTYTADSNGYHPAGAHLPTPPPIPASILKSLEYIRT 114
            .:|     :|.|      :|.:|:|..|:..|.||..|:|..|.|||.|||.|..||:|||||||
  Fly    69 AAGSPLETIGIY------SYTSPEGVPIETRYIADELGFHVVGRHLPQPPPTPDYILRSLEYIRT 127

  Fly   115 HPQ 117
            |.:
  Fly   128 HTE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 17/51 (33%)
Cpr78CbNP_001262144.1 Chitin_bind_4 55..101 CDD:278791 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.