DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Cpr65Ea

DIOPT Version :8

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster

Alignment Length:114 Identity:47/114 - (41%)
Similarity:69/114 - (60%) Gaps:2/114 - (1%)


  Fly     6 VLAVAALAVSCVQADSFDARAETREYKSDLKEDGSYAYQYQTSNGIAGQESGVGGYYASGSNAYY 70
            :|.|.|| ..|..|...:....|: :.::...||:|||..:.::||..:|.|:.|:.|.||.:|.
  Fly     4 LLLVVAL-FGCALAAPLNDDTITK-FLANQDTDGTYAYDIEQASGIQIKEEGLAGHEAHGSYSYI 66

  Fly    71 APDGQLIQLTYTADSNGYHPAGAHLPTPPPIPASILKSLEYIRTHPQQE 119
            :|:|..:|:.||||..|:||....||||||||..||:|:.||:.||..|
  Fly    67 SPEGIPVQVVYTADEFGFHPQSNLLPTPPPIPEEILRSIRYIQEHPTPE 115

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 19/46 (41%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:278791 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48915
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.