powered by:
                   
 
    
    
             
          
            Protein Alignment Cpr65Ec and Acp65Aa
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_648077.1 | Gene: | Cpr65Ec / 38775 | FlyBaseID: | FBgn0035737 | Length: | 127 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_477282.2 | Gene: | Acp65Aa / 38710 | FlyBaseID: | FBgn0020765 | Length: | 105 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 99 | Identity: | 34/99 - (34%) | 
          
            | Similarity: | 48/99 -  (48%) | Gaps: | 13/99 - (13%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     6 VLAVAALAVSCVQADSFDARAETREYKSDLKEDGSYAYQYQTSNGIAGQESGVGGYYAS------ 64:..:.|||.:..|.|     .|..||:|:....|.|.:.|:.|:|.:..|.||.....:
 Fly    11 IALLLALASARPQND-----VEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDNESIS 70
 
 
  Fly    65 --GSNAYYAPDGQLIQLTYTADSNGYHPAGAHLP 96||..:.|||||...:.:.||.||:.|.|||||
 Fly    71 IRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_2EQ63 | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR10380 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 3 | 2.910 |  | 
        
      
           
             Return to query results.
             Submit another query.