DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Acp65Aa

DIOPT Version :10

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:99 Identity:34/99 - (34%)
Similarity:48/99 - (48%) Gaps:13/99 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLAVAALAVSCVQADSFDARAETREYKSDLKEDGSYAYQYQTSNGIAGQESGVGGYYAS------ 64
            :..:.|||.:..|.|     .|..||:|:....|.|.:.|:.|:|.:..|.||.....:      
  Fly    11 IALLLALASARPQND-----VEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDNESIS 70

  Fly    65 --GSNAYYAPDGQLIQLTYTADSNGYHPAGAHLP 96
              ||..:.|||||...:.:.||.||:.|.|||||
  Fly    71 IRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 17/54 (31%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 17/54 (31%)

Return to query results.
Submit another query.