DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Cpr65Av

DIOPT Version :10

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster


Alignment Length:103 Identity:40/103 - (38%)
Similarity:54/103 - (52%) Gaps:13/103 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLAVAALA-VSCVQADSFD--ARAETREYKSD-LKEDGSYAYQYQTSNGIAGQE------SGVGG 60
            |||:.|.| :|.::|...|  ..|....|.:| :..|| |.:.|:||:|:..||      :|...
  Fly     8 VLAICAFALLSTIRAAPLDDSQHATILRYDNDNIGTDG-YNFGYETSDGVTRQEQAEVKNAGTDQ 71

  Fly    61 YYAS--GSNAYYAPDGQLIQLTYTADSNGYHPAGAHLP 96
            ...|  ||.::.|||||...|.|.||.||:.|.|.|||
  Fly    72 EALSVRGSVSWVAPDGQTYTLHYIADENGFQPQGDHLP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 21/54 (39%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 21/54 (39%)

Return to query results.
Submit another query.