DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ec and Cpr65Av

DIOPT Version :9

Sequence 1:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster


Alignment Length:103 Identity:40/103 - (38%)
Similarity:54/103 - (52%) Gaps:13/103 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLAVAALA-VSCVQADSFD--ARAETREYKSD-LKEDGSYAYQYQTSNGIAGQE------SGVGG 60
            |||:.|.| :|.::|...|  ..|....|.:| :..|| |.:.|:||:|:..||      :|...
  Fly     8 VLAICAFALLSTIRAAPLDDSQHATILRYDNDNIGTDG-YNFGYETSDGVTRQEQAEVKNAGTDQ 71

  Fly    61 YYAS--GSNAYYAPDGQLIQLTYTADSNGYHPAGAHLP 96
            ...|  ||.::.|||||...|.|.||.||:.|.|.|||
  Fly    72 EALSVRGSVSWVAPDGQTYTLHYIADENGFQPQGDHLP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 21/54 (39%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:278791 21/54 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.