DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14823 and CG6421

Sequence 1:NP_729205.1 Gene:CG14823 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_652048.2 Gene:CG6421 FlyBaseID:FBgn0025827 Length:161 Species:Drosophila melanogaster

Alignment Length:126 Identity:41/127 (32%)
Similarity:64/127 (50%) Gaps:12/127 (9%)


  Fly   138 CLDCMATTATD-NIPAICRHRGRPEEPCGIYRISHVYWQDALRII----DPDDSLARDYGRCVVD 197
            ||.|:....:. |..|||  ....:..|||:||:..||.||.::.    .||...|  :..|..|
  Fly    35 CLTCICEAISGCNATAIC--TSAEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKA--FINCAKD 95

  Fly   198 VQCAERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCRRQEPLGSLSERRLENCLK 258
            ..||..:|::|:::: .:|||.||.::|.|:.|:|..|..||:...|....|.  .|.|::
  Fly    96 PHCAADLVQNYMKKF-NQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSV--FEECIE 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14823NP_729205.1 Destabilase 136..256 CDD:283215 40/123 (33%)
CG6421NP_652048.2 Destabilase 32..151 CDD:283215 40/123 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4733746
eggNOG 1 0.900 E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S12255
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11195
RoundUp 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.