DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14823 and CG6435

Sequence 1:NP_729205.1 Gene:CG14823 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_611165.2 Gene:CG6435 FlyBaseID:FBgn0034165 Length:163 Species:Drosophila melanogaster

Alignment Length:124 Identity:46/125 (37%)
Similarity:66/125 (53%) Gaps:11/125 (9%)


  Fly   138 CLDCMATTATD-NIPAICRHRGRPEEPCGIYRISHVYWQDALRIIDP-DDSLARD-YGRCVVDVQ 199
            ||||:..|.:. |..|||.:..     |||:||:..||.:|.::..| |.:|:.| :..||....
  Fly    29 CLDCLCETMSGCNASAICVNGA-----CGIFRITWGYWVEAGKLTLPTDTALSEDAFTNCVNQPH 88

  Fly   200 CAERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCRRQEPLGSLSERRLENCLK 258
            ||...|::|:.:: |:|||||..|:|.|...||..|...|  ||.|..:..:....|||
  Fly    89 CAANTVQNYMFKH-GQDCNGDEHIDCLDFGALHKLGNLKC--QEELPYIFAKVFNRCLK 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14823NP_729205.1 Destabilase 136..256 CDD:283215 43/121 (36%)
CG6435NP_611165.2 Destabilase 26..142 CDD:283215 43/121 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4733745
eggNOG 1 0.900 E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11195
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.