DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14823 and CG6426

Sequence 1:NP_729205.1 Gene:CG14823 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_611163.2 Gene:CG6426 FlyBaseID:FBgn0034162 Length:161 Species:Drosophila melanogaster

Alignment Length:152 Identity:45/153 (29%)
Similarity:70/153 (46%) Gaps:28/153 (18%)


  Fly   111 AAGVDAQTSTITTFQPPPTSSPEPSAKCLDCMATTATDNIPAICRHRGRPEEPCGIYRISHVYWQ 175
            ||.:.||...:|..             ||.|:.    :.|....:.|......||::||:..||.
  Fly    21 AALIQAQDKPVTDV-------------CLGCIC----EAISGCNQTRYCGGGVCGLFRITWAYWA 68

  Fly   176 DALRIIDPDDSLARD--YGRCVVDVQCAERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRGPGG 238
            |..::...::|...:  |..||.|..||...:::|:.:: |:|||||..|:|.|...:|..|..|
  Fly    69 DGGKLTLGNESPQSEDAYANCVNDPYCAANTIQNYMTKF-GQDCNGDNAIDCYDFAAIHKLGGYG 132

  Fly   239 CRRQEPLGSLS---ERRLENCL 257
            |:     |.||   :.:|.|||
  Fly   133 CK-----GELSYQYQTQLTNCL 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14823NP_729205.1 Destabilase 136..256 CDD:283215 38/125 (30%)
CG6426NP_611163.2 Destabilase 32..148 CDD:283215 39/139 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4733722
eggNOG 1 0.900 E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S12255
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11195
RoundUp 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.