DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14823 and ilys-4

Sequence 1:NP_729205.1 Gene:CG14823 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_501313.2 Gene:ilys-4 WormBaseID:WBGene00016958 Length:159 Species:Caenorhabditis elegans

Alignment Length:115 Identity:27/116 (23%)
Similarity:47/116 (41%) Gaps:4/116 (3%)


  Fly   133 EPSAKCLDCMATTATDNIPAICRHRGRPEEPCGIYRISHVYWQDALRIIDPDDSLARD-YGRCVV 196
            |....||..|....:..:|..|.........||.:|::...:|...:....|:....: :..|..
 Worm    26 EDDHPCLLAMCDQDSGCVPLGCSVDQFDRIGCGYFRLNIYQFQQCYQPGKKDEDTENEAWMNCAQ 90

  Fly   197 DVQCAERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCRRQEPLG 246
            |.||:...:|:...::..: |.  |:.||....|:|..|..|||.:..:|
 Worm    91 DYQCSASCIRTLATKFRVK-CY--GKSECETIARIHDGGANGCRDRGTIG 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14823NP_729205.1 Destabilase 136..256 CDD:283215 26/113 (23%)
ilys-4NP_501313.2 Destabilase 28..144 CDD:283215 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11195
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
33.070

Return to query results.
Submit another query.