DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14823 and ilys-1

DIOPT Version :10

Sequence 1:NP_729205.1 Gene:CG14823 / 38772 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_500208.2 Gene:ilys-1 / 183474 WormBaseID:WBGene00016668 Length:73 Species:Caenorhabditis elegans


Alignment Length:34 Identity:15/34 - (44%)
Similarity:18/34 - (52%) Gaps:1/34 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 SYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCR 240
            :|..||..: |:|.|..||....|.|..||.|||
 Worm    22 NYYHRYKSQ-CDGLGMGECEVFARNHNGGPTGCR 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14823NP_729205.1 Destabilase 136..256 CDD:461666 15/34 (44%)
ilys-1NP_500208.2 Destabilase <21..68 CDD:461666 15/34 (44%)

Return to query results.
Submit another query.