DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14823 and ilys-1

Sequence 1:NP_729205.1 Gene:CG14823 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_500208.2 Gene:ilys-1 WormBaseID:WBGene00016668 Length:73 Species:Caenorhabditis elegans

Alignment Length:34 Identity:15/35 (43%)
Similarity:18/35 (51%) Gaps:1/35 (3%)


  Fly   207 SYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCR 240
            :|..||..: |:|.|..||....|.|..||.|||
 Worm    22 NYYHRYKSQ-CDGLGMGECEVFARNHNGGPTGCR 54

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14823NP_729205.1 Destabilase 136..256 CDD:283215 15/35 (43%)
ilys-1NP_500208.2 Destabilase <21..68 CDD:283215 15/35 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11195
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.