DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14823 and ilys-5

Sequence 1:NP_729205.1 Gene:CG14823 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001024594.1 Gene:ilys-5 WormBaseID:WBGene00017691 Length:139 Species:Caenorhabditis elegans

Alignment Length:115 Identity:36/116 (31%)
Similarity:49/116 (42%) Gaps:9/116 (8%)


  Fly   135 SAKCLDCMATTATDNIPAICRHRGRPEEPCGIYRISHVYWQDALRIIDP----DDSLARDYGRCV 195
            ||.||.|:....:...|..| |.......||.|:|...|::|..:   |    .::....:.||.
 Worm    17 SADCLHCICMRESGCKPIGC-HMDVGSLSCGYYQIKIGYYEDCGQ---PTKKAGETTEAAWKRCA 77

  Fly   196 VDVQCAERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCRRQEPL 245
            .|:.||...|.:|..||..: |||.|...|:...|.|..||.||.....|
 Worm    78 DDLNCATTCVENYYNRYKSQ-CNGLGMGACQIMSRNHNGGPRGCHNANTL 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14823NP_729205.1 Destabilase 136..256 CDD:283215 35/115 (30%)
ilys-5NP_001024594.1 Destabilase 17..135 CDD:283215 36/116 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2DQ45
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S12255
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T375201
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11195
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.830

Return to query results.
Submit another query.