DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and rasd1

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001072408.1 Gene:rasd1 XenbaseID:XB-GENE-483475 Length:266 Species:Xenopus tropicalis

Alignment Length:271 Identity:137/272 (50%)
Similarity:184/272 (68%) Gaps:23/272 (8%)


  Fly   164 KNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFP 228
            |||||:|:||||:.||:|||:|||..||||.||||||:||||.|.||.||:|||||||||.||||
 Frog    17 KNCYRMVILGSSKVGKTSIVSRFLSGRFEEQYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFP 81

  Fly   229 AMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNK 293
            ||||||.||||:||||||:|:|:|||||.||::.|:|||....|     |.|....:|:::.|||
 Frog    82 AMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQIIETKSCLKN-----KTKENVDVPIVICGNK 141

  Fly   294 CDRDF-KTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMTPNHHRRLVS 357
            .|||| :.||..|: ..:.|:|:.|::.|.||::|..:|::|.:|||::.||.||:|:.||: ||
 Frog   142 VDRDFYREVQPHEI-EQLVGEDSKCSYFEVSAKKNSSLDEMFKALFTMAKLPSEMSPDLHRK-VS 204

  Fly   358 VFGAPSPLPPHGSAVGGTKKNALSIKRRFSDACGVVTPNARRPSIRTDLNLMRSKTMALNEGEGV 422
            |.....   .|..::.|.|      .:...||.|:|.|.||||||.:||..:|:|.:.     |.
 Frog   205 VQYCEI---LHKKSLKGKK------VKEDGDAYGIVAPFARRPSIHSDLMYIRAKAVG-----GG 255

  Fly   423 RSPSRWNRCAL 433
            :|..: .||.:
 Frog   256 QSKDK-ERCVI 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 134/269 (50%)
RAS 167..338 CDD:214541 100/172 (58%)
rasd1NP_001072408.1 Rhes_like 20..266 CDD:133343 134/269 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BHJJ
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7509
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1398885at2759
OrthoFinder 1 1.000 FOG0002840
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.780

Return to query results.
Submit another query.