DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and Rasd2

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_083458.1 Gene:Rasd2 MGIID:1922391 Length:266 Species:Mus musculus

Alignment Length:270 Identity:127/271 (47%)
Similarity:175/271 (65%) Gaps:28/271 (10%)


  Fly   156 CDDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILD 220
            |..::| |||.||:|:||:||.||||||:|||..|||:.||||||:||||:|.|..:::||||||
Mouse    10 CTLNVP-AKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILD 73

  Fly   221 TSGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKI 285
            |||.||||||||||.||||:||||||:||||||:||.||::.|||.|....|     |.|...::
Mouse    74 TSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKN-----KTKEAAEL 133

  Fly   286 PMILAGNKCDRD--FKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMT 348
            ||::.|||.|..  .:.|...|....::|.:||..| |.||::|..::::|:.||:::.||.||:
Mouse   134 PMVICGNKNDHSELCRQVPAMEAELLVSGDENCAYF-EVSAKKNTNVNEMFYVLFSMAKLPHEMS 197

  Fly   349 PNHHRRLVSVFG---APSPLPPHGSAVGGTKKNALSIKRRFSDACGVVTPNARRPSIRTDLNLMR 410
            |..|.::...:|   .|.|.....:.|.|              |.|:|:|.|||||:.:||..::
Mouse   198 PALHHKISVQYGDAFHPRPFCMRRTKVAG--------------AYGMVSPFARRPSVNSDLKYIK 248

  Fly   411 SKTMALNEGE 420
            :|  .|.||:
Mouse   249 AK--VLREGQ 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 122/260 (47%)
RAS 167..338 CDD:214541 95/173 (55%)
Rasd2NP_083458.1 Rhes_like 20..266 CDD:133343 122/260 (47%)
Effector region 48..56 7/8 (88%)
Interaction with GNB1, GNB2 and GNB3. {ECO:0000250} 189..235 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BHJJ
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I3380
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002840
OrthoInspector 1 1.000 T616843
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46149
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5615
TreeFam 1 0.960
98.950

Return to query results.
Submit another query.