DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and Rasd1

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001257883.1 Gene:Rasd1 RGDID:619727 Length:280 Species:Rattus norvegicus

Alignment Length:285 Identity:134/286 (47%)
Similarity:179/286 (63%) Gaps:33/286 (12%)


  Fly   159 SLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSG 223
            |:| ||||||:|:||||:.||::||:|||..|||:|||||||:||||.|.||.||:|||||||||
  Rat    18 SIP-AKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSG 81

  Fly   224 YHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMI 288
            .||||||||||.||||:||||||:|:|:|||||.||::.||:||....|     |.|....:|::
  Rat    82 NHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKN-----KTKENVDVPLV 141

  Fly   289 LAGNKCDRDF-KTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMTPNHH 352
            :.|||.|||| :.|:..|:...:......|.:.|.||::|..:|.:|.:||.::.||.||:|:.|
  Rat   142 ICGNKGDRDFYREVEQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLH 206

  Fly   353 RRLVSVFGAP---------SPLPPHGSAVGGTKKNALSIKRRFSDACGVVTPNARRPSIRTDLNL 408
            |: |||....         ..|...||..||.          ..||.|::.|.|||||:.:||..
  Rat   207 RK-VSVQYCDVLHKKALRNKKLLRAGSGGGGD----------HGDAFGILAPFARRPSVHSDLMY 260

  Fly   409 MRSKTMALNEGEGVRSPSRWNRCAL 433
            :|.||...::.:..      .||.:
  Rat   261 IREKTSVSSQAKDK------ERCVI 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 128/278 (46%)
RAS 167..338 CDD:214541 96/172 (56%)
Rasd1NP_001257883.1 small_GTPase 23..196 CDD:197466 99/178 (56%)
Rhes_like 25..280 CDD:133343 128/278 (46%)
Effector region 53..61 7/8 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BHJJ
Hieranoid 1 1.000
Homologene 1 1.000 H7509
Inparanoid 1 1.050 234 1.000 Inparanoid score I3272
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1398885at2759
OrthoFinder 1 1.000 FOG0002840
OrthoInspector 1 1.000 T618956
orthoMCL 1 0.900 OOG5_139092
Panther 1 1.100 LDO PTHR46149
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1110.830

Return to query results.
Submit another query.