DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and Rgk3

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001286670.1 Gene:Rgk3 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster

Alignment Length:511 Identity:96/512 (19%)
Similarity:155/512 (30%) Gaps:203/512 (40%)


  Fly    28 IH--PSAATTTTPNS--------RNFSASNNNNVRSNSSKSNQQTAAHRGATTHPTQIPHTHHPS 82
            ||  |.|:.:.||..        |..:.|.:..:.|.:....|:|.|.:    ...|..||...:
  Fly    32 IHGMPGASGSATPEGGTPGYRRRRPATRSQSARITSGARSVRQKTKAQQ----QQQQQQHTLQET 92

  Fly    83 TTHSTDE------ASPPQAHVVT--------------FLDESTAGGSNGAVTSSRLVTTAELHQA 127
            .::.|.|      .:|||...::              |||                |.|..:|..
  Fly    93 RSYCTSEPRLSETETPPQRRKLSQRRPQTHAHRKSNAFLD----------------VPTMNMHHL 141

  Fly   128 HMLEHHSNLD-----------AIEQADDF---------------------------IYGPGAGLS 154
            .:.:...::|           .|.:.|.|                           :.|.|:.|.
  Fly   142 RVNDDDEDVDRLRTFSASKGGIINRGDSFRRRRSRSNSLAPSSPMHTRNGVGGLGGVAGGGSSLG 206

  Fly   155 L-CDDSLPSAKN---------------CYRLVMLGSSRAGKSSIVARFLGNRFEEAYT-PTIEEF 202
            | |..:..|:.|               .||:.||||:..||.:::::|..:....||. |..::.
  Fly   207 LGCGYNGGSSSNGFGNANAQENHQPVEFYRVEMLGSAGVGKQALLSQFRTSDCINAYDGPECDDA 271

  Fly   203 HRKLYRIRNEVFQLDILDTSGYHPFPAMRRLSFLTG-----------DLFILVFSMDSRESFEEV 256
            .:.:..|.|                .....|.||||           |.|::|:|...:|||...
  Fly   272 EQNVSIILN----------------GTESELKFLTGNPESKDELEQADAFLVVYSCIDKESFTRA 320

  Fly   257 VRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCDRDFKTVQVDEVMGYIAGQDNCCT--- 318
            .::...:.:             ...|...|.||..||.|......        ::.||..|.   
  Fly   321 KQILSRLQD-------------MDLLRHRPTILVANKIDLARSRA--------VSAQDGKCVACT 364

  Fly   319 ----FVECSARQNYRIDDLFHSLFTVSNL-----PLEMTPNHHRRLVSVFGAPSPLPPHGSAVGG 374
                |:|.|...|:..|:|.....|...|     .|::.|                         
  Fly   365 FGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQLQLNP------------------------- 404

  Fly   375 TKKNALSIKRRFSDACGVVTPNARRPSIRTDLNLMRSKTMALNEG--EGVRSPSRW 428
             ||:....|.:|.:       |....::.||..|...|.   ::|  ....||:.|
  Fly   405 -KKSKDKDKNKFKE-------NTNIETVETDNCLTDLKA---DDGGPRDANSPAHW 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 59/289 (20%)
RAS 167..338 CDD:214541 42/190 (22%)
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:304359 44/198 (22%)
small_GTPase 235..394 CDD:197466 44/196 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120122286
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.