DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and rasd3

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001073403.1 Gene:rasd3 ZFINID:ZDB-GENE-060818-9 Length:211 Species:Danio rerio

Alignment Length:203 Identity:74/204 (36%)
Similarity:100/204 (49%) Gaps:29/204 (14%)


  Fly   160 LPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGY 224
            |...:...|.|.||::..||::::.|||.:||:..||.|:||.|...|.......:::||||||.
Zfish     4 LVQERRTVRFVFLGAAGVGKTALITRFLQDRFDSKYTRTVEELHALEYDTEGARVRIEILDTSGS 68

  Fly   225 HPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMIL 289
            :.|||||.|...|||.|.||::.|..:|.|||.||||.|||.|      |..|       ..:.:
Zfish    69 YSFPAMRALCIRTGDAFALVYAADEPDSLEEVQRLREEILELK------GESF-------TGITV 120

  Fly   290 AGNKCDRDFKTVQ--------VDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLE 346
            ..||.|...::.|        |:|..|  ||      |||.|||....:..:|..|.....||..
Zfish   121 IENKADLCSRSRQATAEAMRAVEEDWG--AG------FVETSARTGDNVTAVFRDLLQQMKLPSR 177

  Fly   347 MTPNHHRR 354
            ::|...||
Zfish   178 VSPALRRR 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 73/197 (37%)
RAS 167..338 CDD:214541 68/179 (38%)
rasd3NP_001073403.1 small_GTPase 9..173 CDD:197466 68/185 (37%)
P-loop_NTPase 12..211 CDD:304359 73/196 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.