DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and rasd2

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001025373.1 Gene:rasd2 ZFINID:ZDB-GENE-050913-57 Length:335 Species:Danio rerio

Alignment Length:337 Identity:114/338 (34%)
Similarity:168/338 (50%) Gaps:53/338 (16%)


  Fly    78 THHPSTTHSTDEASPPQAHVVTFLDESTAGGSNGAVTSSR--LVTTAELHQA-HMLEHHSNLDAI 139
            ::|.:|..::.:.:.|::........||....:.:....|  |...::||:. ||.....|    
Zfish    23 SYHSATVDASLQCTHPESKARVVRSSSTGKRPSSSERKPRRSLDPLSQLHKTKHMRYEVKN---- 83

  Fly   140 EQADDFIYGPGAGLSLCDDSLPSAKNCY--RLVMLGSSRAGKSSIVARFLGNR-FEEAYTPTIEE 201
                              |.|.|.|..:  |:|:||:.|.||::::.||||.. |||.|.||.|:
Zfish    84 ------------------DELVSVKPSHYRRVVVLGAPRVGKTALIRRFLGEEVFEEHYEPTSED 130

  Fly   202 FHRKLYRIRNEVFQLDILDTSGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILET 266
            ||.|||.||.|.:||||||.|....|||.|||:.||||:|:||||:..|:|..||..|||.|...
Zfish   131 FHSKLYHIRGERYQLDILDASKERDFPAKRRLTILTGDIFLLVFSVTDRDSLTEVCSLREEIFTA 195

  Fly   267 KWAALNPGSGFKKKSLPKIPMILAGNKCDRDF-KTVQVDEVMGYIAGQDNCCTFVECSARQNYRI 330
            | :.|.     |.|...::|:|:..||.|.|. :.||..:| ....|:|:  ...|.||:....:
Zfish   196 K-SKLT-----KSKENRQLPIIICANKADVDSPRAVQRSDV-AQCLGEDS--VLFEVSAKTCTNL 251

  Fly   331 DDLFHSLFTVSNLPLEMTPNHHRRL-VSVFGAPSPLPPHGSAVGGTKKNALSIKRRFSDACGVVT 394
            :::|.:|..:..||.|..|:.||.: :..:          .|:...|:|    ||..::.||.|.
Zfish   252 EEVFEALAVLGGLPTETRPSLHRDISIHTY----------HALSSRKRN----KRAVNEPCGAVH 302

  Fly   395 PNARRPSIRTDL 406
            |.|||||..:||
Zfish   303 PLARRPSFSSDL 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 98/246 (40%)
RAS 167..338 CDD:214541 76/175 (43%)
rasd2NP_001025373.1 Rhes_like 95..335 CDD:133343 98/244 (40%)
RAS 95..258 CDD:214541 75/172 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46149
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.