DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and rasd2

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001016006.1 Gene:rasd2 XenbaseID:XB-GENE-494969 Length:266 Species:Xenopus tropicalis

Alignment Length:269 Identity:130/270 (48%)
Similarity:180/270 (67%) Gaps:24/270 (9%)


  Fly   156 CDDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILD 220
            |..|:| |||.||:|:||:||.|||:||:|||..|||:.||||||:||||||.||.:::||||||
 Frog    10 CTLSVP-AKNSYRMVVLGASRVGKSAIVSRFLNGRFEDQYTPTIEDFHRKLYNIRGDMYQLDILD 73

  Fly   221 TSGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKI 285
            |||.||||||||||.||||:||||||:|:|:||:||.|||:.|||.|....|     |.|...:.
 Frog    74 TSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFDEVKRLRKQILEVKSCVKN-----KTKETGEF 133

  Fly   286 PMILAGNKCD--RDFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMT 348
            ||::.|||.|  ...:.|:.:|....::|.:||..| |.||::|..:|.:|..||:::.||.||:
 Frog   134 PMMICGNKSDHGEHHRKVRAEEAERLVSGDENCAYF-EISAKKNINVDKMFQVLFSMAKLPNEMS 197

  Fly   349 PNHHRRLVSVFGAPSPLPPHGSAVGGTKKNALSIKR-RFSDACGVVTPNARRPSIRTDLNLMRSK 412
            |..||::...:|            ....:.:..::| :..||.|:|:|:|||||:.:||..::||
 Frog   198 PALHRKISMQYG------------DTFHQKSFRLRRMKEVDAYGMVSPSARRPSVNSDLKYIKSK 250

  Fly   413 TMALNEGEG 421
              .|.||:|
 Frog   251 --VLGEGQG 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 124/259 (48%)
RAS 167..338 CDD:214541 96/173 (55%)
rasd2NP_001016006.1 Rhes_like 20..266 CDD:133343 124/259 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BHJJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1398885at2759
OrthoFinder 1 1.000 FOG0002840
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.780

Return to query results.
Submit another query.