DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and rasd2

DIOPT Version :9

Sequence 1:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001016006.1 Gene:rasd2 / 548760 XenbaseID:XB-GENE-494969 Length:266 Species:Xenopus tropicalis


Alignment Length:269 Identity:130/269 - (48%)
Similarity:180/269 - (66%) Gaps:24/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 CDDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILD 220
            |..|:| |||.||:|:||:||.|||:||:|||..|||:.||||||:||||||.||.:::||||||
 Frog    10 CTLSVP-AKNSYRMVVLGASRVGKSAIVSRFLNGRFEDQYTPTIEDFHRKLYNIRGDMYQLDILD 73

  Fly   221 TSGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKI 285
            |||.||||||||||.||||:||||||:|:|:||:||.|||:.|||.|....|     |.|...:.
 Frog    74 TSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFDEVKRLRKQILEVKSCVKN-----KTKETGEF 133

  Fly   286 PMILAGNKCD--RDFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMT 348
            ||::.|||.|  ...:.|:.:|....::|.:||..| |.||::|..:|.:|..||:::.||.||:
 Frog   134 PMMICGNKSDHGEHHRKVRAEEAERLVSGDENCAYF-EISAKKNINVDKMFQVLFSMAKLPNEMS 197

  Fly   349 PNHHRRLVSVFGAPSPLPPHGSAVGGTKKNALSIKR-RFSDACGVVTPNARRPSIRTDLNLMRSK 412
            |..||::...:|            ....:.:..::| :..||.|:|:|:|||||:.:||..::||
 Frog   198 PALHRKISMQYG------------DTFHQKSFRLRRMKEVDAYGMVSPSARRPSVNSDLKYIKSK 250

  Fly   413 TMALNEGEG 421
              .|.||:|
 Frog   251 --VLGEGQG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 124/258 (48%)
RAS 167..338 CDD:214541 95/172 (55%)
rasd2NP_001016006.1 Rhes_like 20..266 CDD:133343 124/258 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 197 1.000 Domainoid score I3050
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I3229
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 1 1.000 - - FOG0005519
OrthoInspector 1 1.000 - - otm47504
Panther 1 1.100 - - O PTHR46149
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3937
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.