DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and RASD1

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_057168.1 Gene:RASD1 HGNCID:15828 Length:281 Species:Homo sapiens

Alignment Length:285 Identity:137/286 (48%)
Similarity:179/286 (63%) Gaps:32/286 (11%)


  Fly   159 SLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSG 223
            |:| ||||||:|:||||:.||::||:|||..|||:|||||||:||||.|.||.||:|||||||||
Human    18 SIP-AKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSG 81

  Fly   224 YHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMI 288
            .||||||||||.||||:||||||:|:|:|||||.|||:.||:||....|     |.|....:|::
Human    82 NHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKN-----KTKENVDVPLV 141

  Fly   289 LAGNKCDRDF-KTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMTPNHH 352
            :.|||.|||| :.|...|:...:......|.:.|.||::|..:|.:|.:||.::.||.||:|:.|
Human   142 ICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLH 206

  Fly   353 RRLVSVFGAP---------SPLPPHGSAVGGTKKNALSIKRRFSDACGVVTPNARRPSIRTDLNL 408
            |: |||....         ..|...||..||...         .||.|:|.|.|||||:.:||..
Human   207 RK-VSVQYCDVLHKKALRNKKLLRAGSGGGGGDP---------GDAFGIVAPFARRPSVHSDLMY 261

  Fly   409 MRSKTMALNEGEGVRSPSRWNRCAL 433
            :|.|..|     |.::..: .||.:
Human   262 IREKASA-----GSQAKDK-ERCVI 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 131/278 (47%)
RAS 167..338 CDD:214541 97/172 (56%)
RASD1NP_057168.1 Rhes_like 25..281 CDD:133343 131/278 (47%)
Effector region 53..61 7/8 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BHJJ
Hieranoid 1 1.000
Homologene 1 1.000 H7509
Inparanoid 1 1.050 234 1.000 Inparanoid score I3359
Isobase 1 0.950 0 Normalized mean entropy S1908
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1398885at2759
OrthoFinder 1 1.000 FOG0002840
OrthoInspector 1 1.000 T610035
orthoMCL 1 0.900 OOG5_139092
Panther 1 1.100 LDO PTHR46149
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5615
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.