DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and CG30158

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_652315.2 Gene:CG30158 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster

Alignment Length:280 Identity:88/281 (31%)
Similarity:132/281 (47%) Gaps:55/281 (20%)


  Fly   168 RLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMRR 232
            |||:||.:..||||||.|||...:.:.|..|:|:.:.:.|.:.....::|||||||...||||||
  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72

  Fly   233 LSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCD-- 295
            ||..|...|:||::..|..||:.|.:..|.|.|            ::.....||:::||||.|  
  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIRE------------QRGDFQDIPIVIAGNKADLA 125

  Fly   296 RDFKTVQVDEVMGYIAGQDNC------CTFVECSARQNYRIDDLFHSLFTVSN-LPL-------- 345
            ...:.|:::||..::.    |      ...:||||:::..:.|||.||.::|. ||.        
  Fly   126 TTHREVKLEEVTDWVF----CELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPASSSGSGGS 186

  Fly   346 ----EMTPNHHRRLVSVFGAPSP--------LPPHGSA--VGGTKKNALSIKRRFSDACGVVTPN 396
                |..|:..:|..|.:.:.|.        .|..|.|  .||.||.:..:     ||..|.|.:
  Fly   187 GGGGEAAPSGFKRRSSAYVSASSSRNKNRMNSPALGGAGGSGGDKKGSSLV-----DAVDVATTS 246

  Fly   397 AR---RPSIRTDLNLMRSKT 413
            |.   :|..|:.:.....||
  Fly   247 AEAKLKPRSRSLIRRASRKT 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 88/281 (31%)
RAS 167..338 CDD:214541 64/178 (36%)
CG30158NP_652315.2 Ras 8..172 CDD:206642 64/180 (36%)
Ras 8..170 CDD:278499 64/178 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1908
OrthoDB 1 1.010 D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.