DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and ras-dva1

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001011503.2 Gene:ras-dva1 XenbaseID:XB-GENE-1217929 Length:211 Species:Xenopus tropicalis

Alignment Length:212 Identity:74/213 (35%)
Similarity:110/213 (52%) Gaps:42/213 (20%)


  Fly   162 SAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNE----VFQLDILDTS 222
            |..:..|||..|::..||::::.|||.:||::.|..|:||    :|.:..|    ..::.|||||
 Frog     6 SPSDTVRLVFFGAAGVGKTALIQRFLNDRFDDRYRRTVEE----MYCLNPEPGALQLRIQILDTS 66

  Fly   223 GYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPM 287
            |.:.|||||:||...||.|.||||:...:||:||.|||..|::.|..|             ::|:
 Frog    67 GSYSFPAMRKLSIQQGDAFALVFSLSEPDSFQEVERLRSEIIQVKGDA-------------EVPI 118

  Fly   288 ILAGNKCDRDFKTVQVDEVMGYIAGQ------------DNCCTFVECSARQNYRIDDLFHSLFTV 340
            ::.||         |:|...|..|||            :..|.:||.||:.:||:.|:||.|...
 Frog   119 VVVGN---------QMDLFPGLEAGQQVDLRAAATAELEWDCGYVETSAKVDYRVWDVFHQLIRR 174

  Fly   341 SNLPLEMTPNHHRRLVS 357
            .|.|..::|...||..|
 Frog   175 VNSPAWLSPALERRRAS 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 73/208 (35%)
RAS 167..338 CDD:214541 67/187 (36%)
ras-dva1NP_001011503.2 Ras_dva 12..211 CDD:206714 73/207 (35%)
small_GTPase 12..176 CDD:197466 67/190 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.