DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and CG8500

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001303452.1 Gene:CG8500 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster

Alignment Length:237 Identity:80/238 (34%)
Similarity:115/238 (48%) Gaps:41/238 (17%)


  Fly   161 PSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYH 225
            |...|.||:|:.|:...||||:|.||:...|.|:|.||||:.:|::......:..|.|.||:|.|
  Fly    13 PEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSH 77

  Fly   226 PFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILA 290
            .||||:|||...|..||||:|:.|::|.||        |...||.:..   .|...:|.||::|.
  Fly    78 QFPAMQRLSISKGHAFILVYSVCSKQSLEE--------LRPIWALIKE---LKGADIPNIPVMLV 131

  Fly   291 GNKCDRDFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMTPNHHRRL 355
            |||||...:..:|.:..|.........:|:|.||:.|:.:.:||..|     |.:|.|     |.
  Fly   132 GNKCDETAELREVSQAEGQAQATTWSISFMETSAKTNHNVTELFQEL-----LNMEKT-----RT 186

  Fly   356 VSV----------------FGAPSPLPPHG----SAVGGTKK 377
            ||:                ......:|.:|    ||.||.|:
  Fly   187 VSLQLDTKKQKKQKKEKKSKDTNGSIPENGDAGASASGGAKE 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 78/232 (34%)
RAS 167..338 CDD:214541 65/171 (38%)
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 67/181 (37%)
RAS 31..183 CDD:214541 62/168 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120121746
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.